Contains      

UniProtKB-P51884

Protein Lumican
Gene LUM
Status Reviewed
Source Bladder stromal cell line; Bladder tumor; Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; Colorectal tumors; HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HepG2 cell line (Liver); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Lung tumor; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; Serum; Serum (HCC); Urine; lung; ovarian tumor; plasma
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
88 AFEnVTD 2014(33);
88 AFEnVTDL 2014(33);
88 KAFEnVTD 2013(42);
88 AFEnVTDLQ 2014(14); 2014(33); 2015(unpublished);
88 KAFEnVTDL 2009(64); 2014(33);
88 AFEnVTDLQW 2014(33);
88 KAFEnVTDLQ 2014(33);
88 AFEnVTDLQWL 2014(33);
88 AFEnVTDLQWLILDHN 2015(unpublished);
88 QIDHIDEKAFEnVTDL 2014(33);
88 NNQIDHIDEKAFEnVTDL 2014(33);
88 AFEnVTDLQWLILDHNLLE 2014(33);
88 RNNQIDHIDEKAFEnVTDL 2014(33);
88 LRNNQIDHIDEKAFEnVTDL 2014(33);
88 RNNQIDHIDEKAFEnVTDLQW 2014(33);
88 AFEnVTDLQWLILDHNLLENSK 2005( 81); 2007(63); 2009(64); 2009(59); 2010(60); 2010(40); 2010(53); 2012(34); 2013(38); 2013(38); 2013(40); 2013(42); 2013(45); 2013(45); 2013(35); 2014(15); 2014(31); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;20072007 ;
88 LRNNQIDHIDEKAFEnVTDLQW 2014(33);
88 AFEnVTDLQWLILDHNLLENSKI 2015(unpublished);
88 KAFEnVTDLQWLILDHNLLENSK 2014(33);
88 AFEnVTDLQWLILDHNLLENSKIK 2015(unpublished);2015(8);
88 NNQIDHIDEKAFEnVTDLQWLILDHNLLENSK 2012(53); 2013(38); 2015(unpublished);
127 HINHNnLTE 2014(33);
127 LHINHNnLTE 2014(33);
127 KLHINHNnLTE 2014(33);
127 nLTESVGPLPK 2011(54); 2014(14); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);
127 NnLTESVGPLPK 2014(14);
127 HNnLTESVGPLPK 2014(14); 2014(33); 2015(unpublished);2015(unpublished);
127 IHINHNnITESVG 2013(37);
127 INHNnLTESVGPLPK 2014(14); 2014(33);
127 HINHNnLTESVGPLPK 2014(14); 2014(33);
127 LHINHNnLTESVGPLPK 2005( 81); 2007(63); 2009(64); 2009(65); 2009(65); 2009(68); 2009(59); 2010(60); 2010(40); 2010(3); 2012(49); 2012(53); 2012(34); 2013(38); 2013(38); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(18); 2014(22); 2014(31); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;20072007 ;
127 KLHINHNnLTESVGPLPK 2009(64); 2009(65); 2009(65); 2010(59); 2010(40); 2013(34); 2013(42); 2013(45); 2013(45); 2014(13); 2014(14); 2014(35); 2014(18); 2014(22); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(8);
127 HINHNnLTESVGPLPKSLEDL 2014(33);
127 HINHNnLTESVGPLPKSLEDLQL 2014(33);
127 HINHNnLTESVGPLPKSLEDLQLTH 2014(33);
127 HINHNnLTESVGPLPKSLEDLQLTHN 2014(33);
160 GLVnLTF 2014(33);
160 GLVnLTFIH 2014(33);
160 GSFEGLVnL 2014(33);
160 GLVnLTFIHL 2014(33);
160 LGSFEGLVnL 2014(33);
160 GLVnLTFIHLQ 2014(33);
160 LGSFEGLVnLT 2014(14); 2015(unpublished);
160 LGSFEGLVnLTFI 2014(14); 2015(unpublished);
160 GLVnLTFIHLQHNR 2014(33);
160 LGSFEGLVnLTFIH 2015(unpublished);
160 LGSFEGLVnLTFIHLQH 2014(33); 2015(unpublished);
160 SFEGLVnLTFIHLQHNR 2015(unpublished);
160 IGSFEGIVnITFIHIQHNR 2014(32); 2014(32);
160 LGSFEGLVnLTFIHLQHNR 2005( 81); 2009(64); 2009(68); 2010(40); 2012(53); 2013(34); 2013(38); 2013(38); 2013(38); 2013(38); 2013(42); 2013(45); 2014(13); 2014(35); 2014(18); 2014(31); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
160 LGSFEGLVnLTFIHLQHNRL 2015(unpublished);
252 SFnVSSLVE 2014(33);
252 LADSGIPGNSFnVS 2014(33);
252 SGIPGNSFnVSSLVE 2013(42);
252 SFnVSSLVELDLSYNK 2015(unpublished);
252 LADSGIPGNSFnVSSLVE 2013(42); 2014(33);
252 SHNELADSGIPGNSFnVS 2014(33);
252 LSHNELADSGIPGNSFnVS 2012(3); 2014(33);
252 SHNELADSGIPGNSFnVSSL 2014(33);
252 LSHNELADSGIPGNSFnVSSL 2014(33);
252 RLSHNELADSGIPGNSFnVSSL 2014(33);
252 ISHNEIADSGIPGNSFnVSSIVEIDISYNK 2014(32);
252 LSHNELADSGIPGNSFnVSSLVELDLSYNK 2005( 81); 2009(64); 2013(38); 2013(42); 2014(13); 2014(14); 2014(35); 2014(15); 2014(31); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;
252 RLSHNELADSGIPGNSFnVSSLVELDLSYNK 2015(unpublished);
252 LSHNELADSGIPGNSFnVSSLVELDLSYNKLK 2013(38);

Sequence

1112131415161718191
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHN
101111121131141151161171181191
LLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP
201211221231241251261271281291
SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
301311321331
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
49Kim JY, Kim S-K, Kang D, Moon MH: Dual Lectin-Based Size Sorting Strategy to Enrich Targeted N-Glycopeptides by Asymmetrical Flow Field-Flow Fractionation: Profiling Lung Cancer Biomarkers. Analytical Chemistry 2012, 84:5343-5350.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.