Contains      

UniProtKB-P52798

Protein Ephrin-A4
Gene EFNA4
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate tumor; Urine; UrineJurkat T cell line
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
33 HVVYWnSSNPR 2007(40); 2013(45); 2013(13); 2014(16); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
33 RHVVYWnSSNPRI 2013(37);

Sequence

1112131415161718191
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCS
101111121131141151161171181191
LPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRI
201
L

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.