Contains      

UniProtKB-P54289

Protein Voltage-dependent calcium channel subunit alpha-2/delta-1
Gene CACNA2D1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); Bladder stromal cell line; Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal tumor; HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate stromal cell line; Prostate tumor; Serum; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
92 DIEKLLSnR 2014(18);
136 nDSEPGSQR 2014(22); 2015(1);
136 DIDPEKnDSEPGS 2013(37);
136 DDLDPEKnDSEPGSQR 2005( 81); 2007(57); 2011(3); 2012(50); 2012(34); 2013(13); 2014(14); 2014(22); 2014(33); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;
136 VVYYNAKDDLDPEKnDSEPGSQR 2014(33);
136 EDFASNEVVYYNAKDDLDPEKnDSEPGSQR 2015(1); 2015(unpublished);2015(unpublished);2015(unpublished);
136 NAKDDLDPEKnDSEPGSQRIKPVFIEDANF 2014(33);
184 LnWTSALDE 2012(48); 2014(33);
184 LnWTSALDEVFK 2014(33);
324 DAVNnITAK 2005( 81); 2011(57); 2012(48); 2012(50); 2014(15); 2014(17); 2014(18); 2014(22); 2014(33); 2015(10); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
324 KDAVNnITAK 2014(33);
324 VLKDAVNnITAK 2012(48); 2014(14); 2014(15); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
324 IKDAVNnITAKGI 2013(37);
324 KDAVNnITAKGITDY 2014(33);
348 LLNYnVSR 2012(48);
348 QLLNYnVSR 2012(48); 2014(33);
348 FEQLLNYnVSR 2007(unpublished);2012(48);
348 GFSFAFEQLLNYnVSR 2009(64); 2015(unpublished);2007(unpublished);2007;
468 nITGQFENK 2015(1);
475 NITGQFEnK 2015(1);
475 ITGQFEnKTN 2009(64);
604 IDKGnRTY 2014(33);
613 TWTPVnGTDY 2014(33);
613 TYTWTPVnGTDY 2014(33);
675 ISDnNTEFIINFNEFIDR 2014(32); 2014(32);
675 ISDnNTEFLLNFNEFIDR 2005( 81); 2009(62); 2012(50); 2012(52); 2014(33); 2015(1); 2015(10); 2015(unpublished);2007(unpublished);2007(unpublished);2007;
675 ISDnNTEFLLNFNEFIDRK 2011(57); 2015(1);
781 TAPYFnK 2015(unpublished);
781 FnKSGPGAY 2014(33);
781 VFTAPYFnK 2014(33);
781 YVFTAPYFnK 2007(unpublished);
781 FTAPYFnKSGPGA 2013(37);
781 SIDNDNYVFTAPYFnK 2014(32); 2014(32);
781 SLDNDNYVFTAPYFnK 2012(48); 2012(50); 2012(52); 2013(34); 2014(14); 2014(15); 2014(22); 2014(33); 2015(1); 2015(8); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
781 RSLDNDNYVFTAPYFnK 2012(48); 2015(unpublished);2015(unpublished);
824 IDVNSWIEnFTK 2007(64); 2009(57); 2011(48); 2012(52); 2012(42); 2013(43); 2013(45); 2013(15); 2014(17); 2014(18); 2014(32); 2014(33); 2014(1); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;
888 HLVnISVY 2014(33);
888 HLVnISVYAFNK 2007(45); 2013(9); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
895 AFnKSYDY 2014(33);
895 AFnKSYDYQ 2014(33);
895 HLVNISVYAFnK 2007(45); 2013(9); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
985 FFDnDSKSF 2014(33);
985 QTQYFFDnDSK 2014(33);
985 QSCITEQTQYFFDnDSK 2014(33); 2015(unpublished);2007;
998 DCGnCSRIF 2014(33);
998 SGVLDCGnCSR 2014(33);
998 GVIDCGnCSRIFH 2013(37);
998 SFSGVIDCGnCSR 2014(32);
998 SFSGVLDCGnCSR 2009(65); 2009(65); 2012(50); 2013(42); 2014(14); 2014(15); 2014(17); 2014(22); 2014(33); 2015(8); 2015(10); 2015(12); 2015(unpublished);2015(unpublished);2015;2015;2007;2007;
998 SGVLDCGnCSRIF 2014(33);

Sequence

1112131415161718191
MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRL
101111121131141151161171181191
ALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREED
201211221231241251261271281291
PSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
301311321331341351361371381391
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFNKYNKDKKVRVFTFSVGQHNYDRGPIQ
401411421431441451461471481491
WMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGVDVSLEDIKRL
501511521531541551561571581591
TPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
601611621631641651661671681691
DKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNAD
701711721731741751761771781791
LINRVLLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVEI
801811821831841851861871881891
YIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDY
901911921931941951961971981991
QSVCEPGAAPKQGAGHRSAYVPSVADILQIGWWATAAAWSILQQFLLSLTFPRLLEAVEMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCS
1001101110211031104110511061107110811091
RIFHGEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDGPNPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWYIIGIQFLLLWLVSGSTH
1101
RLL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.