Contains      

UniProtKB-P55083

Protein Microfibril-associated glycoprotein 4
Gene MFAP4
Status Reviewed
Source Bladder stromal cell line; Bladder tumor; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Liver; Non-small Cell Lung Carcinoma; Ovarian tumor; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; Saliva; Serum; Serum (HCC); Spermatozoa; SpermatozoaJurkat T cell line; Urine; UrineJurkat T cell line; ovarian tumor
Years 2005-20072007

Glycosites

Site Identified Peptides Year(Publication ID)
87 FnGSVSF 2014(33);
87 nGSVSFF 2014(33);
87 FnGSVSFF 2014(33);
87 RFnGSVSF 2014(33);
87 FnGSVSFFR 2007(64); 2009(55); 2011(3); 2012(43); 2013(13); 2014(14); 2014(16); 2014(19); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;2007;
87 RFnGSVSFF 2014(33);
87 QKRFnGSVSF 2014(33);
87 RFnGSVSFFR 2009(64); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
87 QKRFnGSVSFF 2014(33);
87 TVFQKRFnGSVSF 2014(33);
87 FnGSVSFFRGWNDY 2014(33);
87 TVFQKRFnGSVSFF 2014(33);
87 RFnGSVSFFRGWNDY 2014(33);
87 RFnGSVSFFRGWNDYK 2014(33);
137 nNTAYAK 2014(33);
137 FEnNTAYAK 2014(33);
137 VDLEDFEnN 2014(33);
137 DFEnNTAYAK 2014(33);
137 LEDFEnNTAY 2014(33);
137 VDLEDFEnNT 2009(64);
137 DFEnNTAYAKY 2014(33);
137 EDFEnNTAYAK 2014(33);
137 ELRVDLEDFEnN 2014(33);
137 LEDFEnNTAYAK 2014(14); 2014(33);
137 VDLEDFEnNTAY 2014(33);
137 RVDLEDFEnNTAY 2014(33);
137 VDLEDFEnNTAYA 2014(33);
137 LRVDLEDFEnNTAY 2014(33);
137 VDIEDFEnNTAYAK 2013(43); 2014(16);
137 VDLEDFEnNTAYAK 2005( 81); 2007(64); 2009(65); 2009(65); 2009(54); 2011(55); 2011(56); 2011(3); 2012(34); 2013(38); 2013(45); 2013(13); 2014(14); 2014(18); 2014(22); 2014(33); 2014(5); 2015(8); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(UnpublishedUnpublished ); 2007;2007;2007;2007;2007;20072007 ;
137 ELRVDLEDFEnNTAY 2014(33);
137 RVDLEDFEnNTAYAK 2014(33); 2015(unpublished);
137 VDLEDFEnNTAYAKY 2014(33);
137 LRVDLEDFEnNTAYAK 2014(33);
137 RVDLEDFEnNTAYAKY 2014(33);
137 ELRVDLEDFEnNTAYAK 2014(33);
137 ELRVDLEDFEnNTAYAKY 2014(33);
137 VDLEDFEnNTAYAKYADF 2014(33);
137 YELRVDLEDFEnNTAYAK 2014(33);
137 ELRVDLEDFEnNTAYAKYA 2014(33);
137 QKYELRVDLEDFEnNTAYAK 2014(33);
137 ELRVDLEDFEnNTAYAKYADF 2014(33);

Sequence

1112131415161718191
MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYK
101111121131141151161171181191
LGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCA
201211221231241251
ALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.