Contains      

UniProtKB-P61916

Protein Epididymal secretory protein E1
Gene NPC2
Status Reviewed
Source ARO Cell Line (Thyroid Cance); Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Human; LNCap/PC3 cell lines (Prostate cancer); Liver; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate cancer metastasis to liver; Prostate tumor; Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; XTC-1 Cell Line (Thyroid Cance); ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
38 EVnVSPCPTQPCQLSK 2009(62); 2009(62); 2009(62); 2012(52); 2014(18); 2007(unpublished);2007(unpublished);
38 DCGSVDGVIKEVnVSPCPTQPCQLSK 2009(62); 2009(62); 2012(52);
58 nVTFTSNIQSK 2015(1);
58 SVnVTFTSNIQSK 2011(57); 2014(33); 2015(unpublished);
58 GQSYSVnVTFTSNIQSK 2009(62); 2009(62); 2009(62); 2009(67); 2011(54); 2012(52); 2013(34); 2013(34); 2013(43); 2013(45); 2014(18); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2007;2007;2007;2007 ;
135 LQDDKnQSL 2009(64);
135 QLQDDKnQSLF 2014(33);
135 WQLQDDKnQSLF 2014(33);
135 VVEWQLQDDKnQSLF 2014(33);
135 WQLQDDKnQSLFCWE 2014(33);
135 LVVEWQLQDDKnQSLF 2014(33);
135 VVEWQLQDDKnQSLFCWEIP 2015(6);
135 WQLQDDKnQSLFCWEIPVQIVSH 2014(33);
135 LVVEWQLQDDKnQSLFCWEIPVQIVSHL 2014(18);

Sequence

1112131415161718191
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCP
101111121131141151
IQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.