Contains      

UniProtKB-P80108

Protein Phosphatidylinositol-glycan-specific phospholipase D
Gene GPLD1
Status Reviewed
Source Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Liver; Lung Adenocarcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Plasma; Prostate; Prostate tumor; Serum; Serum (Colorectal cancer); Serum (HCC); Urine; lung; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
94 LnASVHY 2014(33);
94 nASVHYIR 2007(unpublished);2015(1);
94 TPFLnASVHY 2014(33);
94 STHWTPFLnASVHYIRE 2013(42);
94 FHDVSESTHWTPFLnASVHYIR 2005( 81); 2012(53); 2013(38); 2013(38); 2013(45); 2014(13); 2014(35); 2015(4); 2015(unpublished);2007(unpublished);2007;
307 nLTTSLTE 2014(33);
307 nLTTSLTESVDR 2005( 81); 2007(73); 2007(59); 2010(40); 2010(42); 2013(45); 2013(13); 2014(22); 2014(27); 2014(33); 2014(8); 2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;
307 NDFHRnLTTSLTESVDR 2015(unpublished);2015(4);
307 nLTTSLTESVDRNINYTER 2010(59);
307 MQKNDFHRnLTTSLTESVDR 2015(unpublished);
307 NDFHRnLTTSLTESVDRNINYTER 2015(unpublished);
321 NInYTER 2005( 81); 2007(42); 2013(14); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
321 NLnYTER 2015(unpublished);
321 SVDRNInYTE 2013(42);
321 TESVDRNInY 2014(33);
321 TTSLTESVDRNInY 2014(33);
321 NLTTSLTESVDRNInYTER 2010(59);
321 NDFHRNLTTSLTESVDRNInYTER 2015(unpublished);
568 AAnWTVR 2014(33);
568 NVEAAnW 2014(33);
568 LNVEAAnW 2014(33);
568 AAnWTVRGEE 2013(42);
568 INVEAAnWTVR 2014(16);
568 LNVEAAnWTVR 2005( 81); 2007(40); 2010(3); 2012(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(22); 2014(31); 2014(33); 2014(4); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;
568 EKLNVEAAnWTVR 2015(4);
568 SGPSLSDKEKLNVEAAnW 2014(33);
591 GYSLHGVTVDnR 2007(unpublished);2007(unpublished);2007;
591 SLHGVTVDnRTLL 2014(33);
591 GEEDFSWFGYSLHGVTVDnR 2010(40); 2013(42); 2013(45); 2015(unpublished);2015(4);
604 LVGSPTWKnASRL 2014(33);
604 TLLLVGSPTWKnASR 2013(38); 2015(4);
659 IGTSISSGHVIMnGTIK 2014(16); 2014(32);
659 LGTSLSSGHVLMnGTLK 2005( 81); 2007(64); 2009(40); 2010(38); 2013(39); 2013(42); 2013(45); 2013(13); 2014(35); 2014(36); 2014(21); 2014(22); 2014(31); 2014(33); 2014(4); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;

Sequence

1112131415161718191
MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYI
101111121131141151161171181191
RENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRK
201211221231241251261271281291
VITENVIVDCSHIQFLEMYGEMLAVSKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQ
301311321331341351361371381391
KNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVV
401411421431441451461471481491
GAPGYSRPGHIHIGRVYLIYGNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFGSKQGGMSSSP
501511521531541551561571581591
NITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKEKLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSP
601611621631641651661671681691
TWKNASRLGHLLHIRDEKKSLGRVYGYFPPNGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSD
701711721731741751761771781791
AQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGDMTGKCKSWITPCPEEKAQYVLISPEASSRF
801811821831
GSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
21Liu L, Yu M, Zhang Y, Wang C, Lu H: Hydrazide Functionalized Core-Shell Magnetic Nanocomposites for Highly Specific Enrichment of N-Glycopeptides. Acs Applied Materials & Interfaces 2014, 6:7823-7832.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
27Wang J, Zhou C, Zhang W, Yao J, Lu HJ, Dong QZ, Zhou HJ, Qin LX: An integrative strategy for quantitative analysis of the N-glycoproteome in complex biological samples. Proteome Science 2014, 12.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.