Contains      

UniProtKB-Q06828

Protein Fibromodulin
Gene FMOD
Status Reviewed
Source Bladder stromal cell line; Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Ovarian tumor; Plasma; Platelet; Prostate; Prostate stromal cell line; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
127 GVFDnATGL 2014(33);
127 GVFDnATGLLWIALHGNQITSDK 2014(33);
127 YVYFQNNQITSIQEGVFDnATGLLWIALHGNQITSDK 2013(38);
166 LDHNnLTR 2014(14); 2015(unpublished);
166 YLDHNnLTR 2014(14); 2014(33);
166 IYIDHNnITR 2014(16); 2014(32); 2014(32);
166 LYLDHNnLTR 2007(65); 2009(65); 2009(55); 2011(58); 2011(34); 2013(38); 2013(13); 2014(14); 2014(22); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;
166 RLYLDHNnLTR 2014(33);
166 IYIDHNnITRMPG 2013(37);
166 HLERLYLDHNnLTR 2013(38);
201 GLEnLTALY 2014(33);
201 AIEGIEnITAIYI 2013(37);
201 VPNNALEGLEnLT 2014(14); 2015(unpublished);
201 GLEnLTALYLQHNE 2014(33);
201 VPNNALEGLEnLTAL 2014(14); 2015(unpublished);
201 VPNNALEGLEnLTALY 2014(33);
201 VPNNALEGLEnLTALYLQHN 2015(unpublished);
201 VPNNALEGLEnLTALYLQHNE 2014(33);
201 VPNNAIEGIEnITAIYIQHNEIQEVGSSMR 2014(16);
201 VPNNALEGLEnLTALYLQHNEIQEVGSSMR 2007(64); 2009(34); 2013(33); 2014(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
291 LSHNSLTNNGLASNTFnSSSLLE 2014(33);
291 LSHNSLTNNGLASNTFnSSSLLELDLSYNQLQK 2014(33); 2015(unpublished);2007(unpublished);2007;

Sequence

1112131415161718191
MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYL
101111121131141151161171181191
PFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLE
201211221231241251261271281291
NLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
301311321331341351361371
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

Reference

ID Publication
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.