Contains      

UniProtKB-Q08722

Protein Leukocyte surface antigen CD47
Gene CD47
Status Reviewed
Source 22Rv1 cell line (prostate cancer); 22Rv1 cell xenograft (prostate cancer); ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HEK293 cell line (embryonic kidney); Hela cell line (cervical cancer); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; Jurkat T cell line; K562A cell line (Leukemia); K562S cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lymphocytes; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; PlasmaJurkat T cell line; Platelet; Platelet Plasma membranes; Prostate; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Spermatozoa; TPC-1 Cell Line (Thyroid Cance); Urine; UrineJurkat T cell line; ovarian tumor; prostate cancer cell lines
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
23 QLLFnK 2014(33);
23 nKTKSVEF 2014(33);
23 QLLFnKTK 2014(33);
23 LFnKTKSVEF 2014(33);
23 QLLFnKTKSVEF 2014(33);
34 FTFCnD 2014(33);
34 TFCnDTVVIPC 2014(33);
34 nDTVVIPCFVTNMEAQ 2015(1);
34 FTFCnDTVVIPCFVTNME 2014(33);
34 SVEFTFCnDTVVIPCFVTNMEAQNTTEVYVK 2015(1); 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;
50 nTTEVYVK 2014(14); 2015(unpublished);2015(unpublished);
50 MEAQnTTEVY 2014(33);
50 EAQnTTEVYVK 2015(unpublished);
50 MEAQnTTEVYVK 2015(unpublished);
50 VTNMEAQnTTEVY 2014(33);
50 FVTNMEAQnTTEVY 2014(33);
50 TNMEAQnTTEVYVK 2012(3); 2014(14); 2015(unpublished);
50 FVTNMEAQnTTEVYVK 2007(unpublished);2011(54); 2012(48); 2014(14); 2014(33); 2015(unpublished);
50 SVEFTFCNDTVVIPCFVTNMEAQnTTEVYVK 2015(1); 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;
73 TFDGALnK 2014(33); 2015(unpublished);
73 nKSTVPTDF 2014(33);
73 IYTFDGALnK 2014(33);
73 DIYTFDGAInK 2014(32);
73 DIYTFDGALnK 2007(72); 2007(74); 2007(75); 2007(62); 2009(64); 2009(55); 2011(47); 2012(48); 2012(50); 2012(50); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(45); 2013(13); 2014(14); 2014(15); 2014(19); 2014(22); 2014(25); 2014(25); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;2007;2007;2007;
73 DGALnKSTVPTDF 2014(33);
73 FDGALnKSTVPTD 2009(64);
73 GRDIYTFDGAInK 2013(43);
73 GRDIYTFDGALnK 2012(52); 2013(34); 2013(34); 2013(34); 2014(13); 2014(14); 2014(15); 2014(18); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
73 nKSTVPTDFSSAK 2015(1);
73 TFDGAInKSTVPT 2013(37);
73 TFDGALnKSTVPTDF 2014(33);
73 DIYTFDGALnKSTVPTDFSSAK 2012(50); 2012(52); 2014(14); 2014(15); 2014(18); 2014(33); 2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(12);
73 DGALnKSTVPTDFSSAKIEVSQLL 2014(33);
73 DIYTFDGALnKSTVPTDFSSAKIE 2014(33);
73 GRDIYTFDGAInKSTVPTDFSSAK 2014(16);
73 GRDIYTFDGALnKSTVPTDFSSAK 2011(58); 2012(52); 2014(15); 2014(18); 2015(1); 2015(unpublished);2015(2); 2015(12);
73 TFDGALnKSTVPTDFSSAKIEVSQL 2014(33);
73 GRDIYTFDGALnKSTVPTDFSSAKIE 2014(33);
73 TFDGALnKSTVPTDFSSAKIEVSQLL 2014(33);
73 DGALnKSTVPTDFSSAKIEVSQLLKGDASL 2014(33);
73 DIYTFDGALnKSTVPTDFSSAKIEVSQLLK 2015(1); 2015(unpublished);
111 SDAVSHTGnY 2014(33);
111 nYTCEVTELTR 2015(1);
111 SDAVSHTGnYT 2014(14); 2014(33); 2015(unpublished);
111 SDAVSHTGnYTC 2015(unpublished);
111 AVSHTGnYTCEVT 2013(37);
111 SDAVSHTGnYTCE 2014(33);
111 TGnYTCEVTELTR 2015(unpublished);
111 HTGnYTCEVTELTR 2007(75);
111 KMDKSDAVSHTGnY 2014(33);
111 SDAVSHTGnYTCEV 2014(14); 2015(unpublished);
111 SDAVSHTGnYTCEVT 2014(14); 2015(unpublished);
111 MDKSDAVSHTGnYTCE 2014(33);
111 SDAVSHTGnYTCEVTEITR 2014(32); 2014(32);
111 SDAVSHTGnYTCEVTELTR 2007(72); 2007(74); 2007(62); 2009(62); 2009(58); 2011(50); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(45); 2013(13); 2014(13); 2014(14); 2014(15); 2014(17); 2014(18); 2014(22); 2014(25); 2014(25); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;2007;
111 KMDKSDAVSHTGnYTCEVTEL 2014(33);
111 MDKSDAVSHTGnYTCEVTELTR 2007(75); 2009(64); 2011(58); 2012(48); 2012(52); 2013(34); 2013(34); 2013(34); 2014(13); 2014(14); 2014(15); 2014(18); 2014(25); 2014(33); 2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
111 SDAVSHTGnYTCEVTEITREGETIIEIK 2013(43); 2014(16);
111 SDAVSHTGnYTCEVTELTREGETIIELK 2015(1);

Sequence

1112131415161718191
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKM
101111121131141151161171181191
DKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPG
201211221231241251261271281291
EYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
301311321
PPRKAVEEPLNAFKESKGMMNDE

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
72Hanson SR, Hsu T-L, Weerapana E, Kishikawa K, Simon GM, Cravatt BF, Wong C-H: Tailored glycoproteomics and glycan site mapping using saccharide-selective bioorthogonal probes. Journal of the American Chemical Society 2007, 129:7266-+.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.