Contains      

UniProtKB-Q13361

Protein Microfibrillar-associated protein 5
Gene MFAP5
Status Reviewed
Source Breast tumor; Colorectal tumor; Liver; Ovarian tumor; Pancreatic islets; Prostate tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
79 KnTTAECWDE 2014(33);
79 nTTAECWDEK 2014(22); 2014(33); 2015(unpublished);
79 SEKnTTAECW 2014(33);
79 KnTTAECWDEK 2014(33);
79 LASLSEKnTTAE 2014(33);
79 SEKnTTAECWDEK 2012(3); 2015(unpublished);2007(unpublished);2007;
79 LSEKnTTAECWDEK 2009(64); 2012(48); 2015(unpublished);
79 SEKnTTAECWDEKF 2014(33);

Sequence

1112131415161718191
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRP
101111121131141151161171
VKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.