Contains      

UniProtKB-Q13449

Protein Limbic system-associated membrane protein
Gene LSAMP
Status Reviewed
Source Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HEK293 cell line (embryonic kidney); Liver; Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; Urine; UrineJurkat T cell line; XTC-1 Cell Line (Thyroid Cance)
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
40 nITVR 2014(33);
40 nLTVR 2014(33);
40 GTDnITVR 2007(48); 2012(40); 2013(45); 2013(13); 2014(14); 2014(16); 2014(22); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
40 SVDFNRGTDnITVR 2015(unpublished);2015(unpublished);
66 VAWLnR 2007(33); 2014(unpublished);2015(unpublished);2015;2007;2007;
136 ISnISSDVTVNE 2014(33);
136 ISnISSDVTVNEGSNVTLV 2007(unpublished);
148 ISNISSDVTVNEGSnVTLV 2007(unpublished);
279 TVTnVTEEHYGNY 2014(33);
279 STEGQSSITVTnVTEEHYGNYTCVAANK 2014(16);
279 STEGQSSLTVTnVTEEHYGNYTCVAANK 2014(14); 2014(22); 2015(5); 2015(unpublished);2015(unpublished);2015(Unpublished ); 2015;2015;2007;2007;2007 ;
287 nYTCVAANK 2015(1);
287 GnYTCVAANK 2012(48);
287 HYGnYTCVAANK 2012(48); 2014(33);
287 EHYGnYTCVAANK 2014(33);
287 TVTNVTEEHYGnY 2014(33);
287 STEGQSSITVTNVTEEHYGnYTCVAANK 2014(16);
287 STEGQSSLTVTNVTEEHYGnYTCVAANK 2014(14); 2014(22); 2015(5); 2015(unpublished);2015(unpublished);2015(Unpublished ); 2015;2015;2007;2007;2007 ;
300 LGVTnASLVLFR 2012(48); 2014(23); 2014(33); 2015(unpublished);
300 LGVTnASLVLFRPGS 2007(unpublished);
300 LGVTnASLVLFRPGSV 2012(48);
300 IGVTnASIVIFRPGSVR 2014(16);
300 LGVTnASLVLFRPGSVR 2009(62); 2009(62); 2012(48); 2013(45); 2014(15); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;

Sequence

1112131415161718191
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQK
101111121131141151161171181191
VDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAA
201211221231241251261271281291
NEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN
301311321331
ASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.