Contains      

UniProtKB-Q13510

Protein Acid ceramidase
Gene ASAH1
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); ARO Cell Line (Thyroid Cance); Bladder stromal cell line; Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Lung Adenocarcinoma; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate cancer cell lines; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Serum; TPC-1 Cell Line (Thyroid Cance); Urine; UrineJurkat T cell line; XTC-1 Cell Line (Thyroid Cance); lung; ovarian tumor
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
173 GWNINnDTW 2014(33);
173 LGWNINnDTW 2014(33);
173 NINnDTWVITE 2014(33);
173 GWNINnDTWVITE 2014(33);
173 LGWNINnDTWVITE 2014(33);
173 INnDTWVITEQLKPL 2014(33);
173 NINnDTWVITEQLKPL 2014(33);
173 GWNINnDTWVITEQLKPL 2014(33);
173 LGWNINnDTWVITEQLKPL 2014(33);
173 NINnDTWVITEQLKPLTVNL 2014(33);
173 NMDFGVFLGWNINnDTWVITEQLKPLTVNLDFQR 2015(2);
195 NnKTVFK 2014(14); 2014(16); 2014(33); 2015(2); 2015(unpublished);
195 QRNnKTVF 2014(33);
195 DFQRNnKTVF 2014(33);
195 TVNLDFQRNnKTVF 2014(33);
259 nSTSYEEAK 2014(14); 2014(33); 2015(1);
259 TVLEnSTSY 2014(33);
259 RTVLEnSTSY 2014(33);
259 LEnSTSYEEAK 2014(14); 2014(33); 2015(unpublished);
259 TRTVLEnSTSY 2014(33);
259 TVLEnSTSYEE 2014(33);
259 EnSTSYEEAKNL 2014(33);
259 LTRTVLEnSTSY 2014(33);
259 EnSTSYEEAKNLL 2014(33);
259 FLTRTVLEnSTSY 2014(33);
259 TRTVIEnSTSYEE 2013(37);
259 TVIEnSTSYEEAK 2014(32);
259 TVLEnSTSYEEAK 2003( 83); 2005(81); 2007(62); 2009(62); 2009(62); 2009(62); 2009(62); 2009(63); 2009(54); 2011(55); 2011(57); 2011(58); 2011(3); 2012(47); 2012(50); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(39); 2013(40); 2013(45); 2013(13); 2014(14); 2014(36); 2014(15); 2014(17); 2014(18); 2014(22); 2014(23); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;2007;2007;2007;
259 VLEnSTSYEEAKN 2009(64);
259 LTRTVLEnSTSYEE 2009(64);
259 nSTSYEEAKNLLTK 2015(1);
259 RTVLEnSTSYEEAK 2015(unpublished);
259 TVLEnSTSYEEAKN 2015(unpublished);
259 IGFLTRTVLEnSTSY 2014(33);
259 TVLEnSTSYEEAKNL 2014(33);
259 VLEnSTSYEEAKNLL 2014(33);
259 LEnSTSYEEAKNLLTK 2014(14); 2015(unpublished);
259 TVLEnSTSYEEAKNLL 2014(33);
259 LTRTVLEnSTSYEEAKN 2014(33);
259 TRTVLEnSTSYEEAKNL 2014(33);
259 LTRTVLEnSTSYEEAKNL 2014(33);
259 TRTVLEnSTSYEEAKNLL 2014(33);
259 TVIEnSTSYEEAKNIITK 2014(16);
259 TVLEnSTSYEEAKNLLTK 2009(62); 2009(62); 2009(62); 2009(62); 2012(52); 2014(14); 2014(18); 2014(33); 2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(12);
259 LTRTVLEnSTSYEEAKNLL 2014(33);
259 KDVMWIGFLTRTVLEnSTSYEEAK 2014(33);
286 ILGGnQSGE 2014(33);
286 FILGGnQSGE 2014(33);
286 ILGGnQSGEGC 2009(64); 2014(33);
286 nQSGEGCVITR 2015(1);
286 GGnQSGEGCVITR 2012(48); 2015(unpublished);
286 ILGGnQSGEGCVI 2014(33);
286 YFIIGGnQSGEGC 2013(37);
286 LGGnQSGEGCVITR 2014(14);
286 ILGGnQSGEGCVITR 2007(75); 2011(57); 2012(3); 2012(48); 2014(14); 2014(19); 2014(33); 2015(unpublished);
286 FILGGnQSGEGCVITR 2007(75); 2012(48); 2014(33);
286 ILAPAYFILGGnQSGE 2014(33);
286 ILAPAYFILGGnQSGEG 2014(14); 2015(unpublished);
286 TKILAPAYFILGGnQSGE 2014(33);
286 ILGGnQSGEGCVITRDRKESL 2014(33);
286 IIAPAYFIIGGnQSGEGCVITR 2014(16); 2014(32); 2014(32);
286 ILAPAYFILGGnQSGEGCVITR 2003( 83); 2007(75); 2007(62); 2009(62); 2009(62); 2009(65); 2009(65); 2009(48); 2012(52); 2012(34); 2013(34); 2013(34); 2013(40); 2013(45); 2013(14); 2014(18); 2014(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2015;2007;2007;2007;2007;2007;2007;2007;2007 ;
286 ILGGnQSGEGCVITRDRKESLDVY 2014(33);
286 TKILAPAYFILGGnQSGEGCVITR 2012(52); 2014(33);
342 MCLnR 2014(22);
342 nRTSQENISF 2014(33);
342 CLnRTSQENISF 2014(33);
342 CLnRTSQENISFETMY 2014(33);
342 CLnRTSQENISFETMYDVL 2014(33);
342 MCLnRTSQENISFETMYDVLSTKPVLNK 2015(12);
348 TSQEnISFE 2014(33);
348 NRTSQEnISF 2014(33);
348 CLNRTSQEnISF 2014(33);
348 TSQEnISFETMYDVL 2014(33);
348 CLNRTSQEnISFETMY 2014(33);
348 CLNRTSQEnISFETMYDVL 2014(33);
348 TSQEnISFETMYDVISTKPVINK 2014(16);
348 TSQEnISFETMYDVLSTKPVLNK 2009(62); 2012(52); 2014(14); 2014(33); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
348 MCLNRTSQEnISFETMYDVLSTKPVLNK 2015(12);

Sequence

1112131415161718191
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEK
101111121131141151161171181191
LPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
201211221231241251261271281291
ASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
301311321331341351361371381391
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.