Contains      

UniProtKB-Q14314

Protein Fibroleukin
Gene FGL2
Status Reviewed
Source Breast cancer xenograftsPBMC Macrophage cells; Breast tumor; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; Ovarian tumor; Ovarian tumorPBMC Macrophage cells; Pancreatic islets; Plasma; Platelet; Prostate; Prostate tumor; Saliva; Serum; Urine; ovarian tumor
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
25 NnETEEIK 2007(unpublished);2007(unpublished);2007;
25 NnETEEIKDER 2014(33); 2015(unpublished);
25 NnETEEIKDERAKDVCPVRL 2014(33);
179 VDSKVAnLTF 2014(33);
179 VAnITFVVNSIDGK 2014(16); 2014(32); 2014(32);
179 VAnLTFVVNSLDGK 2005( 81); 2007(64); 2009(56); 2011(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
235 RVTPDPKnSSF 2014(33);
235 RVTPDPKnSSFEVY 2014(33);
235 nSSFEVYCDMETMGGGWTVLQAR 2015(unpublished);
263 IDGSTnFTR 2014(16);
263 LDGSTnFTR 2007(54); 2011(55); 2011(56); 2011(48); 2012(34); 2013(45); 2013(14); 2014(18); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;2007;
263 QARLDGSTnF 2014(33);
263 DGSTnFTRTWQDY 2014(33);
336 nGTAGDALRF 2014(33);
336 NYnGTAGDALR 2014(33);
336 HVGNYnGTAGDAL 2014(33);
336 HVGNYnGTAGDALRF 2014(33);
336 IHVGNYnGTAGDAIR 2014(16); 2014(32);
336 LHVGNYnGTAGDALR 2005( 81); 2007(64); 2009(34); 2013(45); 2013(14); 2014(18); 2014(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;
336 RLHVGNYnGTAGDAL 2014(33);

Sequence

1112131415161718191
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCK
101111121131141151161171181191
LQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQI
201211221231241251261271281291
QSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
301311321331341351361371381391
RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRG
401411421431
VRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Reference

ID Publication
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
55Tian Y, Bova GS, Zhang H: Quantitative glycoproteomic analysis of optimal cutting temperature-embedded frozen tissues identifying glycoproteins associated with aggressive prostate cancer. Analytical chemistry 2011, 83:7013-7019.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.