Contains      

UniProtKB-Q14508

Protein WAP four-disulfide core domain protein 2
Gene WFDC2
Status Reviewed
Source Breast Cancer cell lines; Breast cell lines; Breast tumor; Colorectal tumor; Non-small Cell Lung Carcinoma; Ovarian tumor; Prostate tumor; Saliva; Serum; Urine; XTC-1 Cell Line (Thyroid Cance)
Years 2006-2015

Glycosites

Site Identified Peptides Year(Publication ID)
44 EIQADQnCTQECV 2013(37);
44 TGVCPELQADQnCTQECVSDSECADNLK 2006( 77); 2007(62); 2009(52); 2012(45); 2013(18); 2014(22); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;

Sequence

1112131415161718191
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVD
101111121
SQCPGQMKCCRNGCGKVSCVTPNF

Reference

ID Publication
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.