Contains      

UniProtKB-Q14624

Protein Inter-alpha-trypsin inhibitor heavy chain H4
Gene ITIH4
Status Reviewed
Source Breast tumor; Cerebrospinal fluid; Colorectal tumor; HEK293 cell line (embryonic kidney); Liver; Liver tumor (HCC); Ovarian tumor; Plasma; Platelet; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Saliva; Serum; Serum (HCC); Urine; ovarian tumor; plasma
Years 2004-2015

Glycosites

Site Identified Peptides Year(Publication ID)
81 AFITnF 2014(33);
81 KAFITnF 2014(33);
81 KAFITnFSM 2014(33);
81 ITnFSMIIDGMTYPGIIK 2014(33);
81 AFITnFSMIIDGMTYPGIIK 2009(64); 2010(40); 2011(56); 2012(53); 2013(38); 2013(38); 2014(13); 2014(14); 2014(35); 2014(24); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
81 KAFITnFSMIIDGMTYPGIIK 2010(40); 2012(53); 2013(38); 2014(13); 2014(35); 2014(31); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);
81 AFITnFSMIIDGMTYPGIIKEK 2010(59); 2013(38); 2013(38); 2014(35); 2014(24); 2014(31); 2015(unpublished);
81 KAFITnFSMIIDGMTYPGIIKEK 2013(38); 2014(35); 2015(unpublished);
81 ITnFSMIIDGMTYPGIIKEKAEAQAQY 2014(33);
81 AFITnFSMIIDGMTYPGIIKEKAEAQAQYSAAVAK 2015(unpublished);
81 ANTVQEATFQMELPKKAFITnFSMIIDGMTYPGIIK 2015(unpublished);
207 TTWQnK 2015(unpublished);
207 LTTWQnKTK 2009(64);
207 QLVDALTTWQnK 2007(71); 2007(33); 2014(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;
207 TNQLVDALTTWQnK 2007(71); 2014(33);
207 MTNQLVDALTTWQnK 2007(71); 2010(60); 2014(33); 2015(unpublished);
207 STFMTNQLVDALTTWQnK 2014(33);
207 STFMTNQLVDALTTWQnKTK 2014(33);
207 TESTFMTNQLVDALTTWQnK 2014(33);
207 TESTFMTNQLVDALTTWQnKTK 2014(33);
207 HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQnK 2005(81); 2013(38); 2014(13); 2014(35); 2015(unpublished);
207 HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQnKTK 2015(unpublished);
517 LPTQnITF 2014(33);
517 GKLPTQnITF 2014(33);
517 LPTQnITFQTE 2014(33);
517 SGKLPTQnITF 2014(33);
517 VSGKLPTQnITF 2014(33);
517 TATVSGKLPTQnITF 2014(33);
517 GPDVLTATVSGKLPTQnITFQTE 2014(33);
517 TQnITFQTESSVAEQEAEFQSPK 2015(unpublished);
517 IPTQnITFQTESSVAEQEAEFQSPK 2014(32); 2014(32);
517 LPTQnITFQTESSVAEQEAEFQSPK 2004( 82); 2005(79); 2005(80); 2005(81); 2007(71); 2007(69); 2008(64); 2009(59); 2010(40); 2010(54); 2011(56); 2011(53); 2012(34); 2013(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(15); 2014(22); 2014(24); 2014(26); 2014(28); 2014(31); 2014(33); 2014(5); 2015(7); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(Unpublished ); 2007;2007;2007;2007;2007;2007;2007 ;
517 LQDRGPDVLTATVSGKLPTQnITFQTE 2014(33);
517 TATVSGKLPTQnITFQTESSVAEQEAEF 2014(33);
517 LPTQnITFQTESSVAEQEAEFQSPKYIFHNFMER 2014(13); 2015(unpublished);
517 GPDVLTATVSGKLPTQnITFQTESSVAEQEAEFQSPK 2012(53); 2013(38); 2013(38); 2014(31); 2015(unpublished);2015(unpublished);
517 LQDRGPDVLTATVSGKLPTQnITFQTESSVAEQEAEFQSPK 2010(59); 2012(53); 2013(38); 2013(38); 2014(31); 2015(unpublished);2015(unpublished);
577 NQALnL 2014(33);
577 NQALnLSLAY 2011(54); 2014(33); 2007(unpublished);2007(unpublished);2007(unpublished);2007 (Unpublished );
577 RNQALnLSLAY 2014(33);
577 NQALnLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR 2005(81); 2010(59); 2013(42); 2014(13); 2014(35); 2014(31); 2015(unpublished);

Sequence

1112131415161718191
MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAE
101111121131141151161171181191
AQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVD
201211221231241251261271281291
ALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVIDKSGSMSGRKIQQTREALIKI
301311321331341351361371381391
LDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGTNINDAMLMAVQLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQN
401411421431441451461471481491
NVREAVSGRYSLFCLGFGFDVSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQNNFRLLFKGSEMVVAGKLQDR
501511521531541551561571581591
GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIFHNFMERLWAYLTIQQLLEQTVSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQE
601611621631641651661671681691
QSQVAEKPMEGESRNRNVHSGSTFFKYYLQGAKIPKPEASFSPRRGWNRQAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPA
701711721731741751761771781791
TSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEH
801811821831841851861871881891
VVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQ
901911921
GNDHSATRERRLDYQEGPPGVEISCWSVEL

Reference

ID Publication
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
7Li Y, Shah P, De Marzo AM, Van Eyk JE, Lo Q, Chan DW, Zhang H: Identification of Glycoproteins Containing Specific Glycans Using a Lectin-Chemical Method. Analytical Chemistry 2015, 87:4683-4687.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
26Takakura D, Harazono A, Hashii N, Kawasaki N: Selective glycopeptide profiling by acetone enrichment and LC/MS. Journal of Proteomics 2014, 101:17-30.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
31Zhang L, Jiang H, Yao J, Wang Y, Fang C, Yang P, Lu H: Highly specific enrichment of N-linked glycopeptides based on hydrazide functionalized soluble nanopolymers. Chemical Communications 2014, 50:1027-1029.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
69Calvano CD, Zambonin CG, Jensen ON: Assessment of lectin and HILIC based enrichment protocols for characterization of serum glycoproteins by mass spectrometry. Journal of Proteomics 2008, 71:304-317.
71Hagglund P, Matthiesen R, Elortza F, Hojrup P, Roepstorff P, Jensen ON, Bunkenborg J: An enzymatic deglycosylation scheme enabling identification of core fucosylated N-glycans and O-glycosylation site mapping of human plasma proteins. Journal of Proteome Research 2007, 6:3021-3031.
79Qiu RQ, Regnier FE: Comparative glycoproteomics of N-linked complex-type glycoforms containing sialic acid in human serum. Analytical Chemistry 2005, 77:7225-7231.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.