UniProtKB-Q14982

Protein Opioid-binding protein/cell adhesion molecule
Gene OPCML
Status Reviewed
Source Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; Colorectal tumor; Liver; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
44 AMDnVTVR 2007(48); 2012(45); 2013(22); 2014(33); 2014(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;
70 VAWLnR 2007(33); 2014(unpublished);2015(unpublished);2015;2007;2007;
140 VHLIVQVPPQIMnISSD 2007(unpublished);2007(unpublished);2007;
285 MSTLTFFnVSEK 2012(48); 2013(45); 2014(14); 2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;
285 MSTLTFFnVSEKDYGNYTCVATNK 2013(45); 2015(unpublished);2015(unpublished);2015(unpublished);
293 DYGnYTCVATNK 2007(48); 2012(45); 2013(unpublished);2015(unpublished);2015;2015;2007;2007;
293 MSTLTFFNVSEKDYGnYTCVATNK 2013(45); 2015(unpublished);2015(unpublished);2015(unpublished);
306 LGNTnASITL 2007(unpublished);

Sequence

1112131415161718191
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSI
101111121131141151161171181191
MIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEY
201211221231241251261271281291
ECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATN
301311321331341
KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF

Reference

ID Publication
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.