Contains      

UniProtKB-Q4G148

Protein Glucoside xylosyltransferase 1
Gene GXYLT1
Status Reviewed
Source Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast tumor; Cerebrospinal fluid; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCC cell lines (Liver)Jurkat T cell line; HEK293 cell line (embryonic kidney); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); Jurkat T cell line; K562A cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Platelet; Prostate; Prostate tumor; SW1990 cell line (Pancreatic cancer); Serum; Spermatozoa; Urine
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
237 FnSTQIAAMAPEHEEPR 2007(47); 2012(48); 2012(34); 2013(40); 2013(13); 2014(18); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
237 KFnSTQIAAMAPEHEEPR 2009(64); 2012(48); 2013(34); 2013(34); 2013(38); 2013(38); 2013(43); 2014(13); 2014(16); 2014(32); 2014(32); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(12);
237 nSTQIAAMAPEHEEPRIGW 2014(33);
237 KKFnSTQIAAMAPEHEEPRIGW 2014(33);
278 SGVMIMnMTRMRR 2013(37);
278 TGVNSGVMIMnMTR 2013(43); 2014(16);
278 TGVNSGVMLMnMTR 2005( 81); 2013(34); 2013(34); 2013(40); 2014(13); 2014(14); 2014(25); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;
312 KLnITWGDQDLL 2014(33);
387 nCSFEDDNIR 2013(40); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);
387 ALRnCSFEDDNIR 2014(33);
387 AVYEAIRnCSFEDDNIR 2013(43); 2014(16);
387 AVYEALRnCSFEDDNIR 2013(34); 2013(38); 2014(15); 2014(18); 2014(33); 2015(1);
387 AVYEALRnCSFEDDNIRSLLK 2013(38);

Sequence

1112131415161718191
MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGPAAHPGVSDRCKDFSLCYWNPYWMLPSDVCGMNCFW
101111121131141151161171181191
EAAFRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIFSIKPLQFHIFAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEWKKLFKPCASQR
201211221231241251261271281291
LFLPLILKEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMTRMRRKYFKNDMTTVRLQWGD
301311321331341351361371381391
ILMPLLKKYKLNITWGDQDLLNIVFFHNPESLFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAVYEALRNCSFEDDNIRSLLK
401411421431
PLELELQKTVHTYCGKIYKIFIKQLAKSVRDRYARSPKEK

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.