Contains      

UniProtKB-Q58FF3

Protein Putative endoplasmin-like protein
Gene HSP90B2P
Status Reviewed
Source Breast cancer xenografts; Breast cell lines; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HEK293T cell line (embryonic kidney); Jurkat T cell line; LNCap/PC3 cell lines (Prostate cancer); Liver; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; SKOV-3 cell line (Ovarian cancer)
Years 2011-2015

Glycosites

Site Identified Peptides Year(Publication ID)
138 YnDTFWK 2015(unpublished);
138 IADEKYnDTFWK 2012(48);
159 VIEDHSnR 2012(48);
159 GVIEDHSnR 2012(48);
159 IGVIEDHSnR 2014(16);
159 LGVIEDHSnR 2011(57); 2012(48); 2012(52); 2013(34); 2013(34); 2014(13); 2014(18); 2014(22); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(2); 2015(unpublished);

Sequence

1112131415161718191
MAETIQEVEDEYKAFCKSFSKESDDPVACIHFTAEGEVTFKSILFVPTFVPRGLFDEYGSKKSDYIKLYVRCVFITDDFRDTMPKNLNFVKGVVDSGGLS
101111121131141151161171181191
LNVSCETLQQHKLLKVIRKKLVHKTLDMIKKIADEKYNDTFWKEFGTNIKLGVIEDHSNRTCLAKLLRFQSSHHPADITSLHQDVERMKEKQDKICLMAG
201211221231241251261271281291
GYEVIYLTEPVVEYCIQALPEFDGKRFQNVAKEGVKFDDSEKTKESHEAVEKEFEPLPNWVKDKAIKDKIEKAMVSQCLTESLCALVASQYGWSGNMERI
301311321331341351361371381391
MKAQAYQTGKGISTNYHASRKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVEEPDEEPEETAEDKEQDKDKEMDVGTDEEKQETAKESTAEKDEL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.