Contains      

UniProtKB-Q5KU26

Protein Collectin-12
Gene COLEC12
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); LNCap/PC3 cell lines (Prostate cancer); OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate; Prostate tumor; Spermatozoa; Urine; ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
67 MDnVTGGMETSR 2014(22); 2015(unpublished);2015(unpublished);2007;2007;
159 ETLEnNSFLITTVNK 2011(58); 2014(14); 2014(22); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
168 ETLENNSFLITTVnK 2011(58); 2014(14); 2014(22); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
210 nLTQVQQR 2015(1);
271 VQSLQTLAAnNSALAK 2011(54); 2014(14); 2014(15); 2014(22); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
280 ANnDTLEDMNSQLN 2014(14); 2015(unpublished);
280 ANnDTLEDMNSQLNSFTGQMENITTISQANEQNLK 2015(unpublished);2015(unpublished);
299 nITTISQANEQNLK 2015(1);
299 ANNDTLEDMNSQLNSFTGQMEnITTISQANEQNLK 2015(unpublished);2015(unpublished);
323 DLQDLHKDAEnR 2015(unpublished);2015(unpublished);
349 nISYTAHHLR 2015(1);
349 FQLFETDIVNIISnISYTAHHLR 2015(2); 2015(9);
386 nNTLANIR 2015(1);
386 DDITSInNTIANI 2013(37);
386 HTDDITSInNTIANIR 2013(43);
386 HTDDLTSLnNTLANIR 2014(14); 2014(15); 2014(22); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);
416 LDTEVAnLSVIMEEMK 2011(54); 2015(unpublished);2015(unpublished);2015;2007;2007;
416 SRLDTEVAnLSVIMEEMK 2015(unpublished);2015(unpublished);
437 nFTILQGPPGPR 2015(unpublished);

Sequence

1112131415161718191
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKK
101111121131141151161171181191
AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN
201211221231241251261271281291
VVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
301311321331341351361371381391
TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLR
401411421431441451461471481491
MQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPIGPAGPPGERGGKG
501511521531541551561571581591
SKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
601611621631641651661671681691
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGH
701711721731741
GHGPGEDCAGLIYAGQWNDFQCEDVNNFICEKDRETVLSSAL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.