Contains      

UniProtKB-Q6UX06

Protein Olfactomedin-4
Gene OLFM4
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; Breast tumor; Colorectal tumor; Colorectal tumors; Liver; Lung Adenocarcinoma; Ovarian tumor; Pancreatic islets; Prostate; Prostate tumor; Saliva; Serum; Spermatozoa; Urine; lung; ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
72 FSnFTGSVDDR 2011(54); 2012(48); 2014(14);
72 LFSnFTGSVDDR 2012(48); 2014(14); 2015(unpublished);
72 GSGGSVSQLFSnFTGSVDDR 2015(unpublished);
72 SIGSGGSVSQIFSnFTGSVDDR 2013(43); 2014(32);
72 SLGSGGSVSQLFSnFTGSVDDR 2007(51); 2012(45); 2013(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
136 nITVR 2014(33);
136 nLTVR 2014(33);
136 LLnLTVR 2007(22); 2014(33); 2014(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
136 KLLnLTVR 2012(48); 2015(unpublished);2015(unpublished);2015(unpublished);
193 nMTLLVEK 2007(48); 2012(14); 2014(22); 2014(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
193 nMTLLVEKLETLDK 2009(68);
253 GGVVnISKPSVVQLNWR 2007(unpublished);2007(unpublished);2007;
253 DQNTPVVHPPPTPGSCGHGGVVnISK 2012(48);
253 DQNTPVVHPPPTPGSCGHGGVVnISKPSVV 2012(48);
253 DQNTPVVHPPPTPGSCGHGGVVnISKPSVVQLNW 2012(48);
352 VnLTTNTI 2014(14); 2015(unpublished);
352 NTGNIARVnL 2014(33);
352 VnLTTNTIAV 2014(14); 2015(unpublished);
352 GNIARVnITTNTI 2013(37);
352 VnLTTNTIAVTQTLPNAAYNN 2012(48);
352 VnITTNTIAVTQTIPNAAYNNR 2013(43);
352 VnLTTNTIAVTQTLPNAAYNNR 2007(54); 2011(48); 2012(39); 2013(45); 2013(14); 2014(36); 2014(22); 2014(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;
411 LnDTTLQVLNT 2014(14); 2015(unpublished);
411 MVISKInDTTIQV 2013(37);
411 InDTTIQVINTWYTK 2013(43);
411 LnDTTLQVLNTWYTK 2007(56); 2011(48); 2012(45); 2013(22); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;

Sequence

1112131415161718191
MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVE
101111121131141151161171181191
RLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEK
201211221231241251261271281291
LETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
301311321331341351361371381391
EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEA
401411421431441451461471481491
STGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
501
YDLSVLQKPQ

Reference

ID Publication
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
68Zhang L, Xu Y, Yao H, Xie L, Yao J, Lu H, Yang P: Boronic Acid Functionalized Core-Satellite Composite Nanoparticles for Advanced Enrichment of Glycopeptides and Glycoproteins. Chemistry-a European Journal 2009, 15:10158-10166.