Contains      

UniProtKB-Q7Z3B1

Protein Neuronal growth regulator 1
Gene NEGR1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); Breast cancer cell lines; Breast tumor; Cerebrospinal fluid; LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Pancreatic islets; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
73 GAWLnR 2015(10);
73 MVRKGDTAVLRCYLEDGASKGAWLnRSSIIFA 2007(unpublished);2007(unpublished);2007(unpublished);
155 GTnVTLTCLATGKPEPSISWR 2014(33);
155 IYDISNDMTVNEGTnVTLTCLATGKPEPSISWR 2015(unpublished);2015(unpublished);
275 LFNGQQGIIIQnFSTR 2007(48); 2012(50); 2012(45); 2013(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;
275 KLFNGQQGIIIQnFSTR 2013(45); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);
286 TVTnVTQEHFGNY 2014(33);
286 SILTVTnVTQEHFGNYTCVAANK 2012(48); 2013(45); 2015(5); 2015(10); 2015(unpublished);2015;2015;2007;
294 nYTCVAANK 2015(1);
294 GnYTCVAANK 2012(48);
294 HFGnYTCVAANK 2012(48); 2014(33);
294 TVTNVTQEHFGnY 2014(33);
294 SILTVTNVTQEHFGnYTCVAANK 2012(48); 2013(45); 2015(5); 2015(10); 2015(unpublished);2015;2015;2007;

Sequence

1112131415161718191
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRD
101111121131141151161171181191
YSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGE
201211221231241251261271281291
YECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAA
301311321331341351
NKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.