Contains      

UniProtKB-Q92823

Protein Neuronal cell adhesion molecule
Gene NRCAM
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); Breast Cancer cell lines; Breast cancer xenografts; Breast cell lines; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293T cell line (embryonic kidney); HuH-7 cell line (Liver); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Serum; Urine; XTC-1 Cell Line (Thyroid Cance); umbilical vein Endothelial Cells
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
83 nGTHFDIDK 2013(40);
83 nGTHFDIDKDPLVTMKPGTGTLIINIMSEGK 2015(unpublished);2007(unpublished);2007;
223 nHTQTIQQK 2012(48);
223 FnHTQTIQQK 2011(57); 2012(48); 2013(34); 2013(34); 2013(34); 2013(40); 2013(44); 2014(16); 2014(18); 2014(33); 2015(unpublished);2015(unpublished);2007;2007;
223 ICYARFnHTQTIQ 2013(37);
245 VISVDELnDTIAANLSDTEFYGAK 2011(57); 2012(48); 2013(38); 2015(5); 2015(unpublished);2015(unpublished);2015;2007;2007;
251 DTIAAnLSDTEFYGAK 2012(48);
251 VISVDELNDTIAAnLSDTEFYGAK 2011(57); 2012(48); 2013(38); 2015(5); 2015(unpublished);2015(unpublished);2015;2007;2007;
276 nASNKEELR 2015(1);
276 ERPPTFLTPEGnASNK 2009(63); 2012(48); 2013(38); 2013(40); 2013(44); 2014(22); 2015(unpublished);2015(unpublished);2015(unpublished);2007(Unpublished ); 2007;2007;2007 ;
276 ERPPTFITPEGnASNKEEIR 2014(16);
276 ERPPTFLTPEGnASNKEELR 2005(81); 2009(64); 2012(48); 2012(52); 2014(13); 2014(18); 2015(unpublished);2015(1); 2015(unpublished);2015(unpublished);2015(5);
433 SSAVYQCnASNEYGYLLANAFVNVLAEPPR 2007(unpublished);2007(unpublished);2007 (Unpublished );
507 nGTLEIPVAQK 2015(1);
507 VLHEnGTLEIPVAQKDSTGTY 2014(33);
507 GSAIHEDIYVIHEnGTIEIPVAQK 2014(16);
507 GSALHEDIYVLHEnGTLEIPVAQK 2011(57); 2012(52); 2013(40); 2014(33); 2015(1); 2015(5); 2015(unpublished);2015(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007 ;
507 GSALHEDIYVLHEnGTLEIPVAQKDSTGTYTCVAR 2014(18);
619 FTVDKDHLVVADVSDDDSGTYTCVAnTTLDSV 2007(unpublished);2007 (Unpublished );
716 PYVnYSFR 2012(48);
716 LSPYVnYSFR 2013(40); 2007(unpublished);2007(unpublished);
802 DGDDEWTSVVVAnVSK 2009(63); 2011(57); 2012(48); 2013(38); 2013(40); 2015(unpublished);
802 QKDGDDEWTSVVVAnVSK 2009(63); 2012(48); 2012(50); 2014(16); 2015(5); 2015(unpublished);2015(unpublished);2015;2007;2007;
858 VNVVnSTIAEVHWDPVPIK 2014(16);
858 VNVVnSTLAEVHWDPVPLK 2007(62); 2009(63); 2009(65); 2009(66); 2009(57); 2011(48); 2012(50); 2012(52); 2012(38); 2013(40); 2013(18); 2014(33); 2014(1); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007 ;
993 PInSTHELGPLVDLK 2012(48);
993 YQPInSTHEIGPIVDIK 2014(16); 2014(32);
993 YQPInSTHELGPLVDLK 2007(63); 2009(57); 2011(48); 2012(52); 2012(34); 2013(38); 2013(40); 2013(22); 2014(23); 2014(1); 2015(5); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
1019 NInFSTR 2014(16);
1019 NLnFSTR 2013(40); 2014(14); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;
1288 KEKEPAEGnESSEAPSPVNAMNSF 2007(unpublished);

Sequence

1112131415161718191
MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPG
101111121131141151161171181191
TGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNG
201211221231241251261271281291
DLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
301311321331341351361371381391
IIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAAPYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVP
401411421431441451461471481491
IEIAPDDPSRKIDGDTIIFSNVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHED
501511521531541551561571581591
IYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDH
601611621631641651661671681691
LVVADVSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEV
701711721731741751761771781791
SGTQTTAQLKLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGLQYKVSWRQKDGDDEWTSVVV
801811821831841851861871881891
ANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIE
901911921931941951961971981991
KKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYTLKYQPINSTHELGP
1001101110211031104110511061107110811091
LVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQAVNPRISNLTAAAAETYANISWEYEGPEHVNFYVEY
1101111111211131114111511161117111811191
GVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAVGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPV
1201121112211231124112511261127112811291
KEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAM
1301
NSFV

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
23Pan C, Zhou Y, Dator R, Ginghina C, Zhao Y, Movius J, Peskind E, Zabetian CP, Quinn J, Galasko D, et al: Targeted Discovery and Validation of Plasma Biomarkers of Parkinson's Disease. Journal of Proteome Research 2014, 13:4535-4545.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
66Jia W, Lu Z, Fu Y, Wang H-P, Wang L-H, Chi H, Yuan Z-F, Zheng Z-B, Song L-N, Han H-H, et al: A Strategy for Precise and Large Scale Identification of Core Fucosylated Glycoproteins. Molecular & Cellular Proteomics 2009, 8:913-923.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.