Contains      

UniProtKB-Q96AY3

Protein Peptidyl-prolyl cis-trans isomerase FKBP10
Gene FKBP10
Status Reviewed
Source 22Rv1 cell xenograft (prostate cancer); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); DRO-1 Cell Line (Thyroid Cance); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HeLa cell line (Cervical cancer); Hela cell line (cervical cancer); HuH-7 cell line (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; K562A cell line (Leukemia); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); LnCap cell line (Prostate cancer); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate; Prostate cancer cell lines; Prostate stromal cell line; Prostate tumor; Serum; TPC-1 Cell Line (Thyroid Cance); XTC-1 Cell Line (Thyroid Cance); umbilical vein Endothelial Cells
Years 2003-2015

Glycosites

Site Identified Peptides Year(Publication ID)
70 nGTFEDGK 2015(1);
70 YHYnGTFE 2014(33);
70 nGTFEDGKK 2015(1);
70 YHYnGTFEDGK 2007(75); 2009(62); 2009(62); 2009(62); 2011(57); 2012(48); 2012(50); 2013(34); 2013(38); 2013(40); 2013(44); 2014(14); 2014(17); 2014(18); 2014(22); 2014(25); 2014(32); 2014(33); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
70 HYnGTFEDGKKF 2014(33);
70 YHYnGTFEDGKK 2007(75); 2009(65); 2011(57); 2012(50); 2013(34); 2014(14); 2014(16); 2014(18); 2014(32); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(12);
70 FVRYHYnGTFEDG 2013(37);
70 YHYnGTFEDGKKFDSSYDR 2015(2); 2015(12);
70 EVQMGDFVRYHYnGTFEDGK 2011(57);
182 HYnGTLLDGTSF 2014(33);
182 FVRYHYnGTIIDG 2013(37);
182 HYnGTLLDGTSFDTSY 2014(33);
182 nGTLLDGTSFDTSYSK 2015(1);
182 YHYnGTLLDGTSFDTSY 2011(57);
182 YHYnGTIIDGTSFDTSYSK 2014(16);
182 YHYnGTLLDGTSFDTSYSK 2003( 83); 2007(75); 2009(62); 2009(62); 2009(62); 2009(62); 2009(64); 2009(67); 2011(57); 2012(48); 2013(34); 2014(14); 2014(15); 2014(17); 2014(19); 2014(22); 2014(25); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
182 RYHYnGTLLDGTSFDTSYSK 2015(unpublished);
182 YHYnGTLLDGTSFDTSYSKGG 2015(unpublished);
294 YHYnGSLMD 2014(33);
294 HYnGSLMDGTLF 2014(33);
294 FMRYHYnGSIMDG 2013(37);
294 YHYnGSLMDGTLF 2011(57);
294 HYnGSLMDGTLFDSSY 2014(33);
294 nGSLMDGTLFDSSYSR 2015(1);
294 YHYnGSLMDGTLFDSSY 2011(57);
294 HYnGSLMDGTLFDSSYSR 2015(unpublished);
294 YHYnGSIMDGTIFDSSYSR 2014(16); 2014(32);
294 YHYnGSLMDGTLFDSSYSR 2003( 83); 2007(75); 2009(62); 2011(57); 2013(34); 2013(40); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;
294 RYHYnGSLMDGTLFDSSYSR 2015(unpublished);
294 YHYnGSLMDGTLFDSSYSRN 2015(unpublished);
294 YHYnGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGER 2015(12);
310 nHTYNTY 2014(33); 2015(unpublished);
310 nHTYNTYIGQGY 2011(57); 2015(unpublished);
310 nHTYNTYIGQGYIIPGMDQGLQGACMGER 2011(58); 2013(34); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
310 RnHTYNTYIGQGYIIPGMDQGLQGACMGER 2015(unpublished);
310 YHYNGSLMDGTLFDSSYSRnHTYNTYIGQGYIIPGMDQGLQGACMGER 2015(12);
352 GEnGTGDKIPGSAVL 2014(33);
352 ITIPPHLAYGEnGTGDK 2011(57); 2015(unpublished);2015(2); 2015(unpublished);
352 RITIPPHLAYGEnGTGDK 2011(57);
352 ITIPPHLAYGEnGTGDKIPGSAVLIFNVHVIDFHNPADVVEIR 2015(2);
393 PSETCnETTK 2012(48); 2014(14); 2015(unpublished);2015(unpublished);
393 TLSRPSETCnE 2014(33);
393 SRPSETCnETTK 2015(unpublished);
393 RPSETCnETTKIG 2013(37);
393 TISRPSETCnETTK 2014(16);
393 TLSRPSETCnETTK 2009(62); 2009(62); 2011(57); 2012(50); 2013(34); 2013(38); 2013(40); 2014(14); 2014(15); 2014(17); 2014(18); 2014(22); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(12);
393 SRPSETCnETTKLGDFVRY 2014(33);
393 TLSRPSETCnETTKLGDFVR 2014(18); 2015(12);
407 YHYnCSLLD 2014(33);
407 FVRYHYnCSIIDG 2013(37);
407 HYnCSLLDGTQLF 2014(33);
407 YHYnCSLLDGTQLF 2011(57); 2012(48); 2014(33);
407 YHYnCSLLDGTQLFTSH 2015(unpublished);
407 YHYnCSLLDGTQLFTSHDYGAPQE 2014(33);
407 YHYnCSLLDGTQLFTSHDYGAPQEA 2011(57);
407 YHYnCSLLDGTQLFTSHDYGAPQEATLGANK 2003( 83); 2009(62); 2009(62); 2009(62); 2011(57); 2011(58); 2013(34); 2013(40); 2014(15); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;
407 RYHYnCSLLDGTQLFTSHDYGAPQEATLGANK 2015(unpublished);
407 YHYnCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGER 2015(12);

Sequence

1112131415161718191
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLIT
101111121131141151161171181191
GMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGT
201211221231241251261271281291
YDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCVRRAGAGDFMRYHYNGSLMDG
301311321331341351361371381391
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGD
401411421431441451461471481491
FVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPTGYLFVWHKD
501511521531541551561571581
PPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
25Sun Z, Dong J, Zhang S, Hu Z, Cheng K, Li K, Xu B, Ye M, Nie Y, Fan D, Zou H: Identification of Chemoresistance-Related Cell-Surface Glycoproteins in Leukemia Cells and Functional Validation of Candidate Glycoproteins. Journal of Proteome Research 2014, 13:1593-1601.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.
67McDonald CA, Yang JY, Marathe V, Yen T-Y, Macher BA: Combining Results from Lectin Affinity Chromatography and Glycocapture Approaches Substantially Improves the Coverage of the Glycoproteome. Molecular & Cellular Proteomics 2009, 8:287-301.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.