Contains      

UniProtKB-Q96EE4

Protein Coiled-coil domain-containing protein 126
Gene CCDC126
Status Reviewed
Source Breast cancer xenografts; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Prostate; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
110 nGSAANTTNGTSGNLVPVTTNKR 2007(unpublished);
110 VDYIVVnGSAANTTNGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);2015(unpublished);
110 VDYIVVnGSAANTTNGTSGNLVPVTTNKR 2015(unpublished);2015(unpublished);2015(unpublished);
110 LENKVDYIVVnGSAANTTNGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);
115 NGSAAnTTNGTSGNLVPVTTNKR 2007(unpublished);
115 VDYIVVNGSAAnTTNGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);2015(unpublished);
115 VDYIVVNGSAAnTTNGTSGNLVPVTTNKR 2015(unpublished);2015(unpublished);2015(unpublished);
115 LENKVDYIVVNGSAAnTTNGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);
118 NGSAANTTnGTSGNLVPVTTNKR 2007(unpublished);
118 VDYIVVNGSAANTTnGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);2015(unpublished);
118 VDYIVVNGSAANTTnGTSGNLVPVTTNKR 2015(unpublished);2015(unpublished);2015(unpublished);
118 LENKVDYIVVNGSAANTTnGTSGNLVPVTTNK 2015(unpublished);2015(unpublished);
134 TnVSGSIR 2013(40); 2014(14); 2014(16); 2014(22); 2014(33); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
134 RTnVSGSIR 2013(38); 2013(38);

Sequence

1112131415161718191
MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKL
101111121131
ENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR

Reference

ID Publication
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.