Contains      

UniProtKB-Q96G97

Protein Seipin
Gene BSCL2
Status Reviewed
Source Breast cancer xenografts; DLBCL cell lines (Diffuse large B-cell lymphoma); HEK293 cell line (embryonic kidney); Hela cell line (cervical cancer); Jurkat T cell line; Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Spermatozoa
Years 2013-2015

Glycosites

Site Identified Peptides Year(Publication ID)
88 TDCDSSTTSICSFPVAnVSITK 2013(43); 2014(16);
88 TDCDSSTTSLCSFPVAnVSLTK 2014(13); 2014(15); 2014(17); 2014(33); 2015(unpublished);2015(1); 2015(unpublished);2015(12);

Sequence

1112131415161718191
MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVL
101111121131141151161171181191
MYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLEVELYADYRENSYVPTTGAII
201211221231241251261271281291
EIHSKRIQLYGAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEE
301311321331341351361371381391
STPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTEANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.