Contains      

UniProtKB-Q96PD5

Protein N-acetylmuramoyl-L-alanine amidase
Gene PGLYRP2
Status Reviewed
Source Bladder tumor; Breast tumor; Cerebrospinal fluid; HEK293 cell line (embryonic kidney); Human; Liver; Liver tumor (HCC); Lung Adenocarcinoma; Ovarian tumor; Plasma; Platelet; Prostate; Prostate tumor; Saliva; Serum; Serum (HCC); Urine; lung; ovarian tumor; plasma
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
77 SLnATELDPCPL 2014(33);
77 LYHFLLGAWSLnATE 2014(33);
77 SLnATELDPCPLSPELL 2014(33);
77 YHFLLGAWSLnATELDPCPL 2015(6);
77 SLnATELDPCPLSPELLGLTK 2007(unpublished);2010(60); 2014(28); 2015(unpublished);
77 LYHFLLGAWSLnATELDPCPLSPELLGLTK 2005( 81); 2010(59); 2012(53); 2014(13); 2014(35); 2014(33); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007;2007;
367 VAAnATKEF 2014(33);
367 AQVAAnATKEF 2014(33);
367 QLAQVAAnATK 2014(33);
367 QLAQVAAnATKE 2013(42); 2014(33);
367 VAAnATKEFTEAF 2014(33);
367 SQEQLAQVAAnATK 2014(33); 2015(unpublished);
367 AQVAAnATKEFTEAF 2014(33);
367 MSQEQLAQVAAnATK 2011(54); 2015(unpublished);
367 AQVAAnATKEFTEAFL 2014(33);
367 QLQCMSQEQLAQVAAnATK 2014(33);
367 SQEQLAQVAAnATKEFTEAF 2015(6);
367 IEPVHIQIQCMSQEQIAQVAAnATK 2014(32); 2014(32);
367 LEPVHLQLQCMSQEQLAQVAAnATK 2005( 81); 2007(64); 2009(60); 2010(40); 2010(53); 2012(38); 2013(38); 2013(39); 2013(42); 2013(45); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(15); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(Unpublished ); 2007;2007;2007;2007;2007;2007 ;
367 LEPVHLQLQCMSQEQLAQVAAnATKEFTEAFLGCPAIHPR 2012(53); 2015(unpublished);
485 GFGVAIVGnY 2014(33);
485 GFGVAIVGnYTAALPTE 2014(33);
485 GVAIVGnYTAALPTEAAL 2014(33);
485 GVAIVGnYTAALPTEAALR 2014(33);
485 GFGVAIVGnYTAALPTEAALR 2005( 79); 2005(80); 2005(81); 2007(64); 2009(60); 2010(40); 2010(56); 2011(53); 2012(38); 2013(38); 2013(42); 2013(45); 2013(13); 2014(35); 2014(24); 2014(33); 2014(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;

Sequence

1112131415161718191
MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARH
101111121131141151161171181191
DVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQ
201211221231241251261271281291
ASLPDAKAKSPPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLL
301311321331341351361371381391
SQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
401411421431441451461471481491
QLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVR
501511521531541551561571
DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDLQ

Reference

ID Publication
6Kim DS, Hahn Y: The acquisition of novel N-glycosylation sites in conserved proteins during human evolution. Bmc Bioinformatics 2015, 16.
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
24Song E, Zhu R, Hammond ZT, Mechref Y: LC-MS/MS Quantitation of Esophagus Disease Blood Serum Glycoproteins by Enrichment with Hydrazide Chemistry and Lectin Affinity Chromatography. Journal of Proteome Research 2014, 13:4808-4820.
28Wang Y, Liu M, Xie L, Fang C, Xiong H, Lu H: Highly Efficient Enrichment Method for Glycopeptide Analyses: Using Specific and Nonspecific Nanoparticles Synergistically. Analytical Chemistry 2014, 86:2057-2064.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
53Zhu J, Wang F, Chen R, Cheng K, Xu B, Guo Z, Liang X, Ye M, Zou H: Centrifugation Assisted Microreactor Enables Facile Integration of Trypsin Digestion, Hydrophilic Interaction Chromatography Enrichment, and On-Column Deglycosylation for Rapid and Sensitive N-Glycoproteome Analysis. Analytical Chemistry 2012, 84:5146-5153.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
56Bandhakavi S, Van Riper SK, Tawfik PN, Stone MD, Haddad T, Rhodus NL, Carlis JV, Griffin TJ: Hexapeptide Libraries for Enhanced Protein PTM Identification and Relative Abundance Profiling in Whole Human Saliva. Journal of Proteome Research 2011, 10:1052-1061.
59Lee H-J, Na K, Choi E-Y, Kim KS, Kim H, Paik Y-K: Simple Method for Quantitative Analysis of N-Linked Glycoproteins in Hepatocellular Carcinoma Specimens. Journal of Proteome Research 2010, 9:308-318.
60Liu Z, Cao L, He Y, Qiao L, Xu C, Lu H, Yang P: Tandem O-18 Stable Isotope Labeling for Quantification of N-Glycoproteome. Journal of Proteome Research 2010, 9:227-236.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
80Qiu RQ, Regnier FE: Use of multidimensional lectin affinity chromatography in differential glycoproteomics. Analytical Chemistry 2005, 77:2802-2809.
81Liu T, Qian WJ, Gritsenko MA, Camp DG, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Journal of Proteome Research 2005, 4:2070-2080.