Contains      

UniProtKB-Q99784

Protein Noelin
Gene OLFM1
Status Reviewed
Source Breast cancer xenografts; Cerebrospinal fluid; Colorectal tumor; HCC cell lines (Liver); Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate tumor; Serum; Urine
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
103 VQnMSQSIEVLDR 2005( 81); 2007(40); 2010(48); 2012(40); 2013(42); 2013(13); 2014(14); 2014(18); 2014(22); 2014(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
103 VQnMSQSIEVLDRR 2014(13); 2014(18); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
103 QLLEKVQnMSQSIEVLDR 2014(18);
103 QLLEKVQnMSQSIEVLDRR 2014(18);
187 EEVQnLTSVLNELQEEIGAYDYDELQSR 2005( 81); 2015(8); 2015(10); 2015(unpublished);2007(unpublished);2007;
288 SMVDFMNTDnFTSHR 2005( 81); 2007(73); 2010(40); 2013(42); 2014(13); 2014(18); 2015(8); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;
307 LPHPWSGTGQVVYnGSIYFNK 2014(14); 2015(unpublished);2007(unpublished);2007;
394 LDPVSLQTLQTWnTSYPK 2005( 81); 2013(40); 2014(35); 2014(18); 2015(8); 2015(10); 2015(unpublished);2007(unpublished);2007;
394 LDPVSLQTLQTWnTSYPKR 2014(18); 2015(unpublished);
431 VHYAYQTnASTYE 2007(unpublished);2007(unpublished);2007;
431 VHYAYQTnASTYEYIDIPFQNK 2015(unpublished);2015(unpublished);2015(unpublished);
473 ALYAWNNGHQILYnVTLFHVIR 2015(unpublished);

Sequence

1112131415161718191
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK
101111121131141151161171181191
VQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIG
201211221231241251261271281291
AYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
301311321331341351361371381391
TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKR
401411421431441451461471481
SAGEAFIICGTLYVTNGYSGGTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL

Reference

ID Publication
8Ma C, Zhang Q, Qu JY, Zhao XY, Li X, Liu YP, Wang PG: A precise approach in large scale core-fucosylated glycoprotein identification with low- and high-normalized collision energy. Journal of Proteomics 2015, 114:61-70.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
73Larsen MR, Jensen SS, Jakobsen LA, Heegaard NHH: Exploring the sialiome using titanium dioxide chromatography and mass spectrometry. Molecular & Cellular Proteomics 2007, 6:1778-1787.