Contains      

UniProtKB-Q9BY67

Protein Cell adhesion molecule 1
Gene CADM1
Status Reviewed
Source 22Rv1 cell line (prostate cancer); 22Rv1 cell xenograft (prostate cancer); Bladder stromal cell line; Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); HepG2 cell line (Liver); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lung Adenocarcinoma; Lymphocytes; Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; Pancreatic islets; Plasma; Prostate; Prostate cancer metastasis to liver; Prostate stromal cell line; Prostate tumor; SKOV-3 cell line (Ovarian cancer); Serum; Serum (HCC); Spermatozoa; Urine; lung; ovarian tumor
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
67 VATISCQVnK 2012(48); 2014(33);
67 GEVATISCQVnK 2012(48);
67 SCQVnKSDDSVIQ 2014(33);
67 IEGEVATISCQVnK 2012(48);
67 SCQVnKSDDSVIQL 2014(33);
67 nKSDDSVIQLLNPNR 2015(1);
67 TVIEGEVATISCQVnK 2012(48);
67 DVTVIEGEVATISCQVnK 2007(57); 2011(48); 2012(52); 2012(45); 2013(14); 2014(16); 2014(22); 2014(32); 2014(33); 2014(1); 2015(5); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;2007;2007;
67 DVTVIEGEVATISCQVnKSDDSVIQIINPNR 2013(43); 2014(16);
67 DVTVIEGEVATISCQVnKSDDSVIQLLNPNR 2012(48); 2012(52); 2013(45); 2015(1); 2015(12);
101 nFSSSELK 2015(1);
101 LnFSSSELK 2012(48);
101 FQLLnFSSSE 2014(33);
101 LLnFSSSELK 2011(57); 2012(48); 2014(14); 2015(unpublished);
101 QLLnFSSSEL 2014(33);
101 QLLnFSSSELK 2012(48);
101 FQIInFSSSEIK 2013(43); 2014(16); 2014(32);
101 FQLLnFSSSELK 2005( 81); 2007(64); 2009(65); 2009(65); 2009(40); 2010(57); 2011(48); 2012(50); 2012(50); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(38); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(15); 2014(17); 2014(18); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;2007;2007;
101 FQLLnFSSSELKV 2012(48);
101 SRFQIInFSSSEI 2013(37);
101 DSRFQLLnFSSSELK 2011(57); 2012(48); 2013(38);
113 nVSISDEGR 2012(48); 2015(1);
113 TnVSISDEGR 2012(48);
113 LTnVSISDEGR 2012(48); 2014(33);
113 VSLTnVSISDE 2014(33);
113 SLTnVSISDEGR 2012(48);
113 TnVSISDEGRYF 2014(33);
113 IKVSITnVSISDE 2013(37);
113 VSITnVSISDEGR 2013(43); 2014(16); 2014(32);
113 VSLTnVSISDEGR 2005( 81); 2007(64); 2009(65); 2009(65); 2009(40); 2010(54); 2011(57); 2011(48); 2012(50); 2012(51); 2012(52); 2012(34); 2013(34); 2013(34); 2013(38); 2013(39); 2013(40); 2013(42); 2013(45); 2013(13); 2014(14); 2014(35); 2014(36); 2014(15); 2014(17); 2014(18); 2014(19); 2014(22); 2014(33); 2014(1); 2015(2); 2015(5); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;2007;2007;2007;2007;
113 KVSLTnVSISDEGR 2012(48);
113 VSLTnVSISDEGRY 2014(33);
113 KVSLTnVSISDEGRY 2014(33);
113 VSLTnVSISDEGRYF 2011(57);
113 KVSLTnVSISDEGRYF 2014(33);
165 VnCTAMASK 2012(48); 2014(33);
165 IEVnCTAMASK 2012(48);
165 GEEIEVnCTAMASK 2014(33);
165 VnCTAMASKPATTIR 2012(48); 2014(33);
165 DTAVEGEEIEVnCTAM 2012(48);
165 IEVnCTAMASKPATTIR 2007(unpublished);
165 DTAVEGEEIEVnCTAMASK 2009(65); 2009(65); 2011(57); 2012(48); 2014(14); 2014(33); 2015(unpublished);2015(unpublished);2015(5);
165 DTAVEGEEIEVnCTAMASKPATTIR 2007(48); 2012(52); 2012(34); 2013(34); 2013(45); 2013(13); 2014(14); 2014(32); 2014(32); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007;2007;2007;2007 ;
165 KDTAVEGEEIEVnCTAMASKPATTIR 2012(48);
165 NIMIDIQKDTAVEGEEIEVnCTAMASKPATTIR 2013(43); 2014(16);
165 NLMIDIQKDTAVEGEEIEVnCTAMASKPATTIR 2012(52); 2015(unpublished);
304 NLnKTDNGTYR 2012(48);
304 INNLnKTDNGTY 2014(33);
304 SGPNLFINNLnK 2011(57);
304 INNLnKTDNGTYR 2011(57); 2012(48); 2014(33);
304 AVLSGPNLFINNLnK 2012(48); 2014(33);
304 MPQHAVLSGPNLFINNLnK 2014(33);
304 SGPNLFINNLnKTDNGTYR 2012(48);
304 AVLSGPNLFINNLnKTDNGTYR 2012(48);
304 VDDEMPQHAVISGPNIFINNInK 2013(43); 2014(16);
304 VDDEMPQHAVLSGPNLFINNLnK 2007(57); 2011(48); 2012(52); 2012(45); 2013(22); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2007;2007;2007;2007;
304 VDDEMPQHAVISGPNIFINNInKTDNGTYR 2014(16);
304 VDDEMPQHAVLSGPNLFINNLnKTDNGTYR 2007(48); 2012(52); 2012(34); 2013(45); 2013(1); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
304 VDDEMPQHAVISGPNIFINNInKTDNGTYRCEASNIVGK 2014(16);
308 TDnGTYR 2012(48); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);
308 NLNKTDnGTYR 2012(48);
308 INNLNKTDnGTY 2014(33);
308 INNLNKTDnGTYR 2011(57); 2012(48); 2014(33);
308 TDnGTYRCEASNIVGK 2013(38); 2013(38);
308 SGPNLFINNLNKTDnGTYR 2012(48);
308 AVLSGPNLFINNLNKTDnGTYR 2012(48);
308 VDDEMPQHAVISGPNIFINNINKTDnGTYR 2014(16);
308 VDDEMPQHAVLSGPNLFINNLNKTDnGTYR 2007(48); 2012(52); 2012(34); 2013(45); 2013(1); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;
308 VDDEMPQHAVISGPNIFINNINKTDnGTYRCEASNIVGK 2014(16);
432 GADDAADADTAIINAEGGQnNSEEK 2012(52); 2014(15);
432 GADDAADADTAIINAEGGQnNSEEKKEYFI 2014(15);
432 THEAKGADDAADADTAIINAEGGQnNSEEKKEY 2014(33);

Sequence

1112131415161718191
MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLL
101111121131141151161171181191
NFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYT
201211221231241251261271281291
VTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI
301311321331341351361371381391
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFA
401411421431441
RHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
5Goyallon A, Cholet S, Chapelle M, Junot C, Fenaille F: Evaluation of a combined glycomics and glycoproteomics approach for studying the major glycoproteins present in biofluids: Application to cerebrospinal fluid. Rapid Communications in Mass Spectrometry 2015, 29:461-473.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
35Chen J, Shah P, Zhang H: Solid phase extraction of N-linked glycopeptides using hydrazide tip. Analytical chemistry 2013, 85:10670-10674.
36Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW: Glycoproteomic analysis of bronchoalveolar lavage (BAL) fluid identifies tumor-associated glycoproteins from lung adenocarcinoma. Journal of proteome research 2013, 12:3689-3696.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
39Li QK, Shah P, Li Y, Aiyetan PO, Chen J, Yung R, Molena D, Gabrielson E, Askin F, Chan DW, Zhang H: Glycoproteomic Analysis of Bronchoalveolar Lavage (BAL) Fluid Identifies Tumor-Associated Glycoproteins from Lung Adenocarcinonna. Journal of Proteome Research 2013, 12:3689-3696.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
65Goo YA, Lilu AY, Ryu S, Shaffer SA, Malmstrom L, Page L, Nguyen LT, Doneanu CE, Goodlett DR: Identification of Secreted Glycoproteins of Human Prostate and Bladder Stromal Cells by Comparative Quantitative Proteomics. Prostate 2009, 69:49-61.