Contains      

UniProtKB-Q9H3G5

Protein Probable serine carboxypeptidase CPVL
Gene CPVL
Status Reviewed
Source ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cell lines; Breast tumor; Cerebrospinal fluid; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); FTC-133 Cell Line (Thyroid Cance); HCC cell lines (Liver); HCCLM3 cell line (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Platelet; Prostate; Prostate tumor; Spermatozoa; Urine; XTC-1 Cell Line (Thyroid Cance)
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
81 LTVnKTY 2014(33);
81 AGFLTVnK 2014(33);
81 AGFLTVnKTY 2014(33);
81 SYAGFITVnK 2013(43); 2014(16);
81 SYAGFLTVnK 2007(62); 2009(62); 2009(62); 2009(52); 2012(38); 2013(40); 2013(45); 2013(14); 2014(22); 2014(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
81 KSYAGFLTVnK 2014(33); 2015(unpublished);
81 LTVnKTYNSNL 2009(64);
81 TVnKTYNSNLF 2014(33);
81 LTVnKTYNSNLF 2014(33);
81 MKSYAGFLTVnK 2014(33);
81 AGFITVnKTYNSN 2013(37);
81 LTVnKTYNSNLFF 2014(33);
132 VVTSnMTLR 2007(33); 2014(unpublished);2015(unpublished);2007;2007;
132 HGPYVVTSnMTLR 2014(33);
132 VEHGPYVVTSnMTL 2009(64);
132 FVEHGPYVVTSnMTL 2009(64);
132 VEHGPYVVTSnMTLR 2014(33); 2015(unpublished);
132 GLFVEHGPYVVTSnMTLR 2015(unpublished);
132 VVTSnMTLRDRDFPWTTTL 2014(33);
307 QnVTGCSNYY 2014(33);
307 FQnVTGCSNYY 2014(33);
307 DPSYFQnVTGCSN 2013(37);
307 nVTGCSNYYNFLR 2015(1);
307 LLDGDLTSDPSYFQnV 2014(14);
307 LLDGDLTSDPSYFQnVTG 2011(57);
307 LLDGDLTSDPSYFQnVTGC 2014(33);
307 IIDGDITSDPSYFQnVTGCSNY 2014(32);
307 LLDGDLTSDPSYFQnVTGCSNY 2014(33);
307 LLDGDLTSDPSYFQnVTGCSNYY 2011(57); 2014(33);
307 IIDGDITSDPSYFQnVTGCSNYYNFIR 2013(43);
307 ILDKLLDGDLTSDPSYFQnVTGCSNYY 2014(33);
307 LLDGDLTSDPSYFQnVTGCSNYYNFLR 2007(62); 2009(45); 2013(33); 2014(1); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;2007;2007;
346 QAIHVGnQTF 2014(33);
346 nQTFNDGTIVEK 2015(1);
346 QAIHVGnQTFND 2014(33);
346 GnQTFNDGTIVEK 2014(33);
346 QAIHVGnQTFNDG 2013(37);
346 HVGnQTFNDGTIVEK 2014(33);
346 VGnQTFNDGTIVEKY 2014(33);
346 HVGnQTFNDGTIVEKY 2014(33);
346 IHVGnQTFNDGTIVEK 2011(57);
346 IHVGnQTFNDGTIVEKY 2014(33);
346 LSLPEVRQAIHVGnQTF 2014(33);
346 QAIHVGnQTFNDGTIVE 2014(33);
346 QAIHVGnQTFNDGTIVEK 2007(62); 2009(62); 2009(62); 2009(63); 2009(64); 2009(57); 2011(58); 2011(52); 2012(38); 2013(40); 2013(43); 2013(45); 2013(14); 2014(15); 2014(16); 2014(18); 2014(19); 2014(32); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;2007;
346 QAIHVGnQTFNDGTIVEKY 2014(33);
346 LSLPEVRQAIHVGnQTFNDGTIVEKY 2014(33);

Sequence

1112131415161718191
MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPE
101111121131141151161171181191
DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYV
201211221231241251261271281291
TGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLDGDLTS
301311321331341351361371381391
DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFNDGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSL
401411421431441451461471
MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
19Huang G, Sun Z, Qin H, Zhao L, Xiong Z, Peng X, Ou J, Zou H: Preparation of hydrazine functionalized polymer brushes hybrid magnetic nanoparticles for highly specific enrichment of glycopeptides. Analyst 2014, 139:2199-2206.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.