Contains      

UniProtKB-Q9H741

Protein UPF0454 protein C12orf49
Gene C12orf49
Status Reviewed
Source Breast Cancer cell lines; DLBCL cell lines (Diffuse large B-cell lymphoma); HCCLM3 cell line (Liver); HepG2 cell line (Liver); HuH-7 cell line (Liver); Jurkat T cell line; OVCAR-3 cell line (Ovarian cancer); Prostate tumor; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
67 nSSRPSNQCR 2015(1);
67 VQFNLGnSSR 2007(63); 2009(unpublished);2007(unpublished);2007;
67 VQFNIGnSSRPSN 2013(37);
67 VQFNIGnSSRPSNQCR 2014(16);
67 VQFNLGnSSRPSNQCR 2013(38); 2013(38); 2014(13); 2015(unpublished);2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLV
101111121131141151161171181191
NGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPP
201
ELFPA

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.