Contains      

UniProtKB-Q9NPF2

Protein Carbohydrate sulfotransferase 11
Gene CHST11
Status Reviewed
Source Breast Cancer cell lines; Breast cancer xenografts; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HCCLM3 cell line (Liver); HuH-7 cell line (Liver); Ovarian tumor; Pancreatic islets; Prostate; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
205 YnISFHK 2013(38);
205 YnISFHKR 2014(16);
223 nATQEALR 2012(48); 2013(40); 2014(14); 2015(unpublished);
223 KnATQEALR 2012(48);
223 QRKnATQEAIR 2014(16);
223 IKRQRKnATQEAI 2013(37);
321 TTDEMTTEFFQnISSEH 2007(unpublished);
321 TTDEMTTEFFQnISSEHQTQLYEVYK 2015(unpublished);2015(unpublished);2015(unpublished);
342 LDFLMFnYSVPSYLK 2009(63); 2013(40); 2015(unpublished);2015(unpublished);2015(unpublished);

Sequence

1112131415161718191
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRR
101111121131141151161171181191
VLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKF
201211221231241251261271281291
TQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
301311321331341351
FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE

Reference

ID Publication
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
63Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-Glycosylation Sites on Secreted Proteins of Human Hepatocellular Carcinoma Cells with a Complementary Proteomics Approach. Journal of Proteome Research 2009, 8:662-672.