Contains      

UniProtKB-Q9UJJ9

Protein N-acetylglucosamine-1-phosphotransferase subunit gamma
Gene GNPTG
Status Reviewed
Source Breast Cancer cell lines; Cerebrospinal fluid; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); Liver; Liver tumor (HCC); OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Plasma; Prostate tumor; Serum
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
88 HnVTQHEQTF 2014(33);
88 nVTQHEQTFR 2015(1);
88 FCPFHnVTQHE 2012(48); 2014(33);
88 YEFCPFHnVTQH 2012(48);
88 EFCPFHnVTQHEQ 2013(37);
88 PFHnVTQHEQTFR 2012(48);
88 YEFCPFHnVTQHE 2012(48);
88 CPFHnVTQHEQTFR 2012(48);
88 EFCPFHnVTQHEQTF 2014(33);
88 FCPFHnVTQHEQTFR 2012(48);
88 EFCPFHnVTQHEQTFR 2012(48);
88 YEFCPFHnVTQHEQTFR 2012(48); 2013(40); 2014(13); 2014(16); 2014(32); 2014(33); 2015(1); 2015(unpublished);2015(unpublished);2007(unpublished);2007;2007;
115 IAnNTFTGMWMR 2014(33);

Sequence

1112131415161718191
MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNA
101111121131141151161171181191
YSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELI
201211221231241251261271281291
TPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPG
301
LRGSL

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.