Contains      

UniProtKB-Q9UNN8

Protein Endothelial protein C receptor
Gene PROCR
Status Reviewed
Source Breast cell lines; HCC cell lines (Liver); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; LNCap/PC3 cell lines (Prostate cancer); Liver; Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Prostate tumor; Serum; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
47 nASLGGHLTHVLEGPDT 2015(1);
47 DPYHVWYQGnASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWAR 2012(52); 2013(40); 2013(45); 2015(unpublished);
64 GPDTnTTIIQLQPLQEPE 2013(42);
64 TnTTIIQLQPLQEPESWAR 2007(unpublished);2007(unpublished);
64 VLEGPDTnTTIIQLQPLQEPESWAR 2007(unpublished);2007(75);
64 DPYHVWYQGNASLGGHLTHVLEGPDTnTTIIQLQPLQEPESWAR 2012(52); 2013(40); 2013(45); 2015(unpublished);
136 VAVnGSSFVSFRPE 2013(42);
136 VAVnGSSFVSFRPER 2007(33); 2014(unpublished);2007(unpublished);2007;
136 AHVFFEVAVnGSSFVSFRPER 2013(45); 2015(unpublished);2015(unpublished);
172 TLQQLNAYnR 2007(unpublished);2015(unpublished);
172 ALWQADTQVTSGVVTFTLQQLNAYnR 2007(75); 2012(51); 2012(52); 2013(45); 2015(2); 2015(unpublished);2007(unpublished);2007(unpublished);2007;

Sequence

1112131415161718191
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLV
101111121131141151161171181191
HQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTK
201211221231
GSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
51Yeh C-H, Chen S-H, Li D-T, Lin H-P, Huang H-J, Chang C-I, Shih W-L, Chern C-L, Shi F-K, Hsu J-L: Magnetic bead-based hydrophilic interaction liquid chromatography for glycopeptide enrichments. Journal of Chromatography A 2012, 1224:70-78.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.