Contains      

UniProtKB-Q9Y2E5

Protein Epididymis-specific alpha-mannosidase
Gene MAN2B2
Status Reviewed
Source ARO Cell Line (Thyroid Cance); Breast Cancer cell lines; Breast cancer cell lines; Breast cancer xenografts; Breast cell lines; Breast tumor; Cerebrospinal fluid; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); Hela cell line (cervical cancer); HuH-7 cell line (Liver); LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Non-small Cell Lung Carcinoma; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Prostate; Prostate cancer metastasis to liver; Prostate tumor; Serum; TPC-1 Cell Line (Thyroid Cance); Urine; UrineJurkat T cell line; XTC-1 Cell Line (Thyroid Cance); XTC-1 Cell Line (Thyroid Cance)Jurkat T cell line
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
226 SYCTPSHIPFSnR 2014(33);
226 QEIFTHIMDQYSYCTPSHIPFSnR 2009(62); 2009(62); 2009(62); 2014(16);
249 SGFYWNGVAVFPKPPQDGVYPnMSEPVTPANINLYAEALVANVK 2015(unpublished);
336 AIHAInVTWR 2014(16); 2014(32);
336 ALHALnVTWR 2007(62); 2009(62); 2009(40); 2013(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2007;2007;
336 RAIHAInVTWRVR 2013(37);
516 AGHPVPSQIQnSTETPSAY 2014(33);
516 AGHPVPSQIQnSTETPSAYD 2014(33);
516 VTDEAGHPVPSQIQnSTETPSAY 2014(33);
516 TVGFPGVRVTDEAGHPVPSQIQnSTETPSAY 2014(33);
516 VTDEAGHPVPSQIQnSTETPSAYDIIIITTIPGISYR 2014(32); 2014(32);
516 VTDEAGHPVPSQIQnSTETPSAYDLLILTTIPGLSYR 2007(62); 2009(64); 2009(52); 2012(33); 2014(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(Unpublished ); 2007;2007 ;
670 YRnMTAQNY 2014(33);
670 FYRnMTAQNY 2014(33);
670 nMTAQNYTYAIR 2007(62); 2009(62); 2009(13); 2014(14); 2014(33); 2014(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
675 nYTYAIR 2015(1);
675 YRNMTAQnY 2014(33);
675 FYRNMTAQnY 2014(33);
675 NMTAQnYTYAIR 2007(62); 2009(62); 2009(13); 2014(14); 2014(33); 2014(2); 2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;
748 RPYVSYVnN 2014(33);
748 VnNSIARNY 2014(33);
748 VSYVnNSIAR 2014(33);
748 VSYVnNSIARN 2014(33);
748 YVSYVnNSIAR 2014(14); 2015(unpublished);
748 VSYVnNSIARNY 2014(33);
748 PYVSYVnNSIARN 2013(37);
748 RPYVSYVnNSIAR 2007(62); 2009(62); 2009(62); 2009(48); 2012(52); 2012(40); 2013(45); 2013(13); 2014(14); 2014(16); 2014(32); 2014(33); 2014(1); 2015(2); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015;2007;2007;2007;2007;2007;2007;
748 QMQRRPYVSYVnNSIAR 2015(unpublished);
808 nLTLNDTSVVHPVLW 2014(33);
812 TLnDTSVVHPVLW 2014(33);
812 NLTLnDTSVVHPVLW 2014(33);
890 GWRYSSnHTEHSQ 2013(37);
890 YSSnHTEHSQNIR 2014(16);
890 YSSnHTEHSQNLR 2013(38); 2013(40); 2014(18); 2015(unpublished);2015(unpublished);2015(12);
890 YSSnHTEHSQNLRK 2013(38);

Sequence

1112131415161718191
MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLL
101111121131141151161171181191
EEGRLEFVIGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDLKAAMQEARGLQFVWRGSPSL
201211221231241251261271281291
SERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPPQDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFA
301311321331341351361371381391
NMDPLLDHINSHAAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTGFYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDP
401411421431441451461471481491
TWALQQLQQLRWAVSEVQHHDAITGTESPKVRDMYATHLASGMLGMRKLMASIVLDELQPQAPMAASSDAGPAGHFASVYNPLAWTVTTIVTLTVGFPGV
501511521531541551561571581591
RVTDEAGHPVPSQIQNSTETPSAYDLLILTTIPGLSYRHYNIRPTAGAQEGTQEPAATVASTLQFGRRLRRRTSHAGRYLVPVANDCYIVLLDQDTNLMH
601611621631641651661671681691
SIWERQSNRTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVEMEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRI
701711721731741751761771781791
EQEYQAGPLELNREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNN
801811821831841851861871881891
FDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTTALRQRSALALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRK
901911921931941951961971981991
GHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIR
1001
TFFIHFQQQ

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
37Boersema PJ, Geiger T, Wisniewski JR, Mann M: Quantification of the N-glycosylated Secretome by Super-SILAC During Breast Cancer Progression and in Human Blood Samples. Molecular & Cellular Proteomics 2013, 12:158-171.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.