Contains      

UniProtKB-Q9Y5Y7

Protein Lymphatic vessel endothelial hyaluronic acid receptor 1
Gene LYVE1
Status Reviewed
Source Breast cancer xenografts; Breast tumor; Colorectal tumor; HCC cell lines (Liver); Liver; Ovarian tumor; Plasma; Prostate; Prostate tumor; Serum; Serum (HCC); Urine; ovarian tumor; plasma; umbilical vein Endothelial Cells
Years 2005-2015

Glycosites

Site Identified Peptides Year(Publication ID)
53 ANQQLnFTE 2014(33);
53 KANQQLnFTE 2014(33);
53 ANQQLnFTEAK 2005( 81); 2007(64); 2009(40); 2010(54); 2011(3); 2012(38); 2013(38); 2013(42); 2013(44); 2013(45); 2013(45); 2013(13); 2014(14); 2014(22); 2014(33); 2014(4); 2015(7); 2015(10); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2007;2007;2007;2007;2007;
53 ANQQLnFTEAKE 2014(33);
53 KANQQInFTEAK 2014(32);
53 KANQQLnFTEAK 2009(64); 2013(40); 2013(42); 2013(45); 2013(45); 2014(13); 2014(14); 2014(22); 2014(33); 2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);2015(unpublished);
53 KANQQLnFTEAKE 2014(33);
53 KANQQLnFTEAKEACR 2015(unpublished);2015(unpublished);
289 AnDSNPNEESK 2015(unpublished);

Sequence

1112131415161718191
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRI
101111121131141151161171181191
SPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLI
201211221231241251261271281291
CVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKT
301311321
DKNPEESKSPSKTTVRCLEAEV

Reference

ID Publication
3Tian Y, Almaraz RT, Choi CH, Li QK, Saeui C, Li D, Shah P, Bhattacharya R, Yarema KJ, Zhang H: Identification of sialylated glycoproteins from metabolically oligosaccharide engineered pancreatic cells. Clinical proteomics 2015, 12:11.
4Cheow ESH, Sim KH, de Kleijn D, Lee CN, Sorokin V, Sze SK: Simultaneous Enrichment of Plasma Soluble and Extracellular Vesicular Glycoproteins Using Prolonged Ultracentrifugation-Electrostatic Repulsion-hydrophilic Interaction Chromatography (PUC-ERLIC) Approach. Molecular & Cellular Proteomics 2015, 14:1657-1671.
7Li Y, Shah P, De Marzo AM, Van Eyk JE, Lo Q, Chan DW, Zhang H: Identification of Glycoproteins Containing Specific Glycans Using a Lectin-Chemical Method. Analytical Chemistry 2015, 87:4683-4687.
10Tan ZJ, Yin HD, Nie S, Lin ZX, Zhu JH, Ruffin MT, Anderson MA, Simone DM, Lubman DM: Large-Scale Identification of Core-Fucosylated Glycopeptide Sites in Pancreatic Cancer Serum Using Mass Spectrometry. Journal of Proteome Research 2015, 14:1968-1978.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
38Kaji H, Ocho M, Togayachi A, Kuno A, Sogabe M, Ohkura T, Nozaki H, Angata T, Chiba Y, Ozaki H, et al: Glycoproteomic Discovery of Serological Biomarker Candidates for HCV/HBV Infection-Associated Liver Fibrosis and Hepatocellular Carcinoma. Journal of Proteome Research 2013, 12:2630-2640.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
42Ma C, Zhao X, Han H, Tong W, Zhang Q, Qin P, Chang C, Peng B, Ying W, Qian X: N-linked glycoproteome profiling of human serum using tandem enrichment and multiple fraction concatenation. Electrophoresis 2013, 34:2440-2450.
44Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M: Glycoproteomic Analysis of the Secretome of Human Endothelial Cells. Molecular & Cellular Proteomics 2013, 12:956-978.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.