Contains      

UniProtKB-Q9Y639

Protein Neuroplastin
Gene NPTN
Status Reviewed
Source 22Rv1 cell line (prostate cancer); Breast cancer cell lines; Breast cancer xenografts; Breast cancer xenograftsPBMC Macrophage cells; Breast cell lines; Breast tumor; Colorectal cancer cell line, HCT-116 (colorectal cancer); Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); HCC cell lines (Liver); HEK293 cell line (embryonic kidney); HEK293T cell line (embryonic kidney); HEK293T cell line (embryonic kidney), HEK293T cell line (embryonic kidney); Hela cell line (cervical cancer); IGROV-1/CP cell line (Ovarian cancer)IGROV-1/CP; Jurkat T cell line; LNCap/PC3 cell lines (Prostate cancer); Liver; Liver tumor (HCC); Lymphocytes; OVCAR-3 cell line (Ovarian cancer); Ovarian cancer cell lines; Ovarian tumor; PBMC Macrophage cells; Pancreatic islets; Platelet; Platelet Plasma membranes; Prostate; Prostate tumor; SKOV-3 cell line (Ovarian cancer); SW1990 cell line (Pancreatic cancer); Spermatozoa; SpermatozoaJurkat T cell line; Urine; UrineJurkat T cell line; ovarian tumor
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
171 QCnLTSSSH 2014(33);
171 QCnLTSSSHTL 2014(33);
171 QCnLTSSSHTLTY 2014(33);
171 DSPVLPVTLQCnLTSS 2014(33);
171 nLTSSSHTLTYSYWTK 2015(1);
171 DSPVLPVTLQCnLTSSSH 2011(54); 2012(48); 2014(33); 2015(unpublished);2007(unpublished);2007;
171 DSPVLPVTLQCnLTSSSHTL 2011(57); 2014(33);
171 DSPVLPVTLQCnLTSSSHTLTY 2011(57); 2014(33);
171 DSPVIPVTIQCnITSSSHTITYSYWTK 2013(43); 2014(16);
171 DSPVLPVTLQCnLTSSSHTLTYSYWTK 2007(75); 2011(58); 2012(52); 2013(34); 2013(34); 2015(unpublished);2015(1); 2015(2); 2015(unpublished);2015(9); 2015(12);
171 IVTSEEVIIRDSPVLPVTLQCnLTSSSHTLTYSYWTK 2011(58); 2015(2);
197 nASNMEYR 2011(57); 2011(58); 2012(48); 2012(50); 2013(45); 2014(16); 2014(22); 2014(33); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015;2007;2007;
197 KnASNMEYR 2011(58); 2012(48); 2013(40); 2014(16); 2014(22); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(12);
197 SATRKnASNMEY 2014(33);
197 NGVELSATRKnASNMEYR 2011(58); 2012(52); 2015(2);
229 AnATIEVK 2007(74); 2007(75); 2011(54); 2011(57); 2012(47); 2012(48); 2012(50); 2012(52); 2013(34); 2013(40); 2013(45); 2014(13); 2014(14); 2014(15); 2014(16); 2014(17); 2014(22); 2014(33); 2015(1); 2015(2); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2015;2015;2015;2015;2007;2007;2007;
229 VSAPKAnATIEVK 2014(33);
229 HFVSAPKAnATIEVK 2014(33);
229 AnATIEVKAAPDITGHK 2012(48);
229 VSAPKAnATIEVKAAPDITGH 2014(33);
229 AEDSGEYHCVYHFVSAPKAnATIEVK 2011(58);
229 INKPRAEDSGEYHCVYHFVSAPKAnATIEVK 2011(58);
284 IVnTSGRF 2009(64);
284 DIVnTSGRF 2014(33);
284 DIVnTSGRFF 2014(33);
284 PMDIVnTSGR 2012(48);
284 GMPMDIVnTSGR 2012(48); 2015(unpublished);
284 NGMPMDIVnTSGR 2014(33);
284 ENGMPMDIVnTSGR 2011(54); 2011(57); 2011(58); 2012(48); 2012(52); 2013(34); 2013(34); 2013(43); 2014(13); 2014(14); 2014(22); 2014(32); 2014(32); 2014(33); 2015(1); 2015(2); 2015(9); 2015(12); 2015(unpublished);2015(unpublished);2015(unpublished);2007(unpublished);2007(unpublished);2007(unpublished);2007;2007;2007;
284 KENGMPMDIVnTSGR 2011(57); 2012(52); 2013(34); 2014(13); 2014(22); 2014(33); 2015(unpublished);2015(1); 2015(2); 2015(12);
284 KKENGMPMDIVnTSGR 2007(unpublished);2007(75); 2011(58); 2012(52); 2013(34); 2013(34); 2013(34); 2014(13); 2014(14); 2014(16); 2014(33); 2015(1); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);2015(12);
284 RKKENGMPMDIVnTSGRF 2014(33);
284 RKKENGMPMDIVnTSGRFF 2014(33);
296 IINKEnYTE 2009(64);
296 IINKEnYTEL 2014(33);
296 FFIINKEnYTE 2014(33);
296 FIINKEnYTEL 2014(33);
296 FFIINKEnYTEL 2014(33); 2007(unpublished);2007(unpublished);
317 ECnATNAIGSASVV 2014(33);
317 nATNAIGSASVVTVLR 2015(1);
317 CnATNAIGSASVVTVLR 2014(33);
317 ECnATNAIGSASVVTVL 2014(33);

Sequence

1112131415161718191
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSV
101111121131141151161171181191
LRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASN
201211221231241251261271281291
MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
301311321331341351361371381391
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
9Smeekens JM, Chen WX, Wu RH: Mass Spectrometric Analysis of the Cell Surface N-Glycoproteome by Combining Metabolic Labeling and Click Chemistry. Journal of the American Society for Mass Spectrometry 2015, 26:604-614.
12Weng Y, Sui Z, Jiang H, Shan Y, Chen L, Zhang S, Zhang L, Zhang Y: Releasing N-glycan from Peptide N-terminus by N-terminal Succinylation Assisted Enzymatic Deglycosylation. Scientific Reports 2015, 5.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
15Chen R, Seebun D, Ye M, Zou H, Figeys D: Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS. Journal of Proteomics 2014, 103:194-203.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
17Fang C, Xiong Z, Qin H, Huang G, Liu J, Ye M, Feng S, Zou H: One-pot synthesis of magnetic colloidal nanocrystal clusters coated with chitosan for selective enrichment of glycopeptides. Analytica Chimica Acta 2014, 841:99-105.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
32Zhang Z, Sun Z, Zhu J, Liu J, Huang G, Ye M, Zou H: High-Throughput Determination of the Site-Specific N-Sialoglycan Occupancy Rates by Differential Oxidation of Glycoproteins Followed with Quantitative Glycoproteomics Analysis. Analytical Chemistry 2014, 86:9830-9837.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
40Li X, Jiang J, Zhao X, Wang J, Han H, Zhao Y, Peng B, Zhong R, Ying W, Qian X: N-glycoproteome Analysis of the Secretome of Human Metastatic Hepatocellular Carcinoma Cell Lines Combining Hydrazide Chemistry, HILIC Enrichment and Mass Spectrometry. Plos One 2013, 8.
43Wang GG, Wu YB, Zhou T, Guo YS, Zheng B, Wang J, Bi Y, Liu FJ, Zhou ZM, Guo XJ, Sha JH: Mapping of the N-Linked Glycoproteome of Human Spermatozoa. Journal of Proteome Research 2013, 12:5750-5759.
45Zhou H, Froehlich JW, Briscoe AC, Lee RS: The GlycoFilter: A Simple and Comprehensive Sample Preparation Platform for Proteomics, N-Glycomics and Glycosylation Site Assignment. Molecular & Cellular Proteomics 2013, 12:2981-2991.
47Almaraz RT, Tian Y, Bhattarcharya R, Tan E, Chen S-H, Dallas MR, Chen L, Zhang Z, Zhang H, Konstantopoulos K: Metabolic flux increases glycoprotein sialylation: implications for cell adhesion and cancer metastasis. Molecular & Cellular Proteomics 2012, 11:M112. 017558.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
50Whitmore TE, Peterson A, Holzman T, Eastham A, Amon L, McIntosh M, Ozinsky A, Nelson PS, Martin DB: Integrative Analysis of N-Linked Human Glycoproteomic Data Sets Reveals PTPRF Ectodomain as a Novel Plasma Biomarker Candidate for Prostate Cancer. Journal of Proteome Research 2012, 11:2653-2665.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.
54Tian Y, Yao Z, Roden R, Zhang H: Identification of glycoproteins associated with different histological subtypes of ovarian tumors using quantitative glycoproteomics. Proteomics 2011, 11:4677-4687.
57Chen Y, Cao J, Yan G, Lu H, Yang P: Two-step protease digestion and glycopeptide capture approach for accurate glycosite identification and glycoprotein sequence coverage improvement. Talanta 2011, 85:70-75.
58Nagano K, Shinkawa T, Kato K, Inomata N, Yabuki N, Haramura M: Distinct cell surface proteome profiling by biotin labeling and glycoprotein capturing. Journal of Proteomics 2011, 74:1985-1993.
64Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res 2009, 8:651-661.
74Lewandrowski U, Zahedi RP, Moebius J, Walter U, Sickmann A: Enhanced N-glycosylation site analysis of Sialoglycopeptides by strong cation exchange prefractionation applied to platelet plasma membranes. Molecular & Cellular Proteomics 2007, 6:1933-1941.
75Sun B, Ranish JA, Utleg AG, White JT, Yan X, Lin B, Hood L: Shotgun glycopeptide capture approach coupled with mass Spectrometry for comprehensive glycoproteomics. Molecular & Cellular Proteomics 2007, 6:141-149.