Contains      

UniProtKB-Q9Y680

Protein Peptidyl-prolyl cis-trans isomerase FKBP7
Gene FKBP7
Status Reviewed
Source Colorectal tumor; DLBCL cell lines (Diffuse large B-cell lymphoma); Jurkat T cell line; Liver; Non-small Cell Lung Carcinoma; Ovarian tumor; Pancreatic islets; Prostate tumor; TPC-1 Cell Line (Thyroid Cance); Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
45 LHRPEnCSK 2012(48);
45 VLHRPEnCSK 2012(48); 2014(33);
45 EVLHRPEnCSK 2012(48);
45 IEVIHRPEnCSK 2014(16);
45 IEVLHRPEnCSK 2009(62); 2012(48); 2013(34); 2014(13); 2014(22); 2014(33); 2015(unpublished);
45 EESTEEVKIEVLHRPEnCSK 2009(62); 2013(34); 2014(33);
45 KEESTEEVKIEVLHRPEnCSK 2014(18);
158 CMYLLVLNnNTCAEGK 2007(unpublished);2007(unpublished);2007;

Sequence

1112131415161718191
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAM
101111121131141151161171181191
TDMCPGEKRKVVIPPSFAYGKEGYGSLEEVFLLQNILVSCHRTTLHVLKCMYLLVLNNNTCAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDR
201211221231241251
QLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

Reference

ID Publication
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
18Hirao Y, Matsuzaki H, Iwaki J, Kuno A, Kaji H, Ohkura T, Togayachi A, Abe M, Nomura M, Noguchi M, et al: Glycoproteomics Approach for Identifying Glycobiomarker Candidate Molecules for Tissue Type Classification of Non-small Cell Lung Carcinoma. Journal of Proteome Research 2014, 13:4705-4716.
22Nicastri A, Gaspari M, Sacco R, Elia L, Gabriele C, Romano R, Rizzuto A, Cuda G: N-Glycoprotein Analysis Discovers New Up-Regulated Glycoproteins in Colorectal Cancer Tissue. Journal of Proteome Research 2014, 13:4932-4941.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
62Arcinas A, Yen T-Y, Kebebew E, Macher BA: Cell Surface and Secreted Protein Profiles of Human Thyroid Cancer Cell Lines Reveal Distinct Glycoprotein Patterns. Journal of Proteome Research 2009, 8:3958-3968.