Contains      

UniProtKB-Q9Y6X5

Protein Bis(5'-adenosyl)-triphosphatase ENPP4
Gene ENPP4
Status Reviewed
Source Breast cancer xenografts; Breast cell lines; DLBCL cell lines (Diffuse large B-cell lymphoma); Jurkat T cell line; LNCap/PC3 cell lines (Prostate cancer); Liver; OVCAR-3 cell line (Ovarian cancer); Ovarian tumor; Pancreatic islets; Platelet; Prostate; Prostate tumor; Urine
Years 2007-2015

Glycosites

Site Identified Peptides Year(Publication ID)
128 TNQLQEnR 2014(14);
128 AVPIWVTNQLQEnR 2014(33);
128 HFSDSNDKDPFWWNEAVPIWVTNQIQEnR 2014(16);
155 nSSVSFEER 2015(1);
155 MNYnSSVSFEER 2012(48); 2014(33);
155 FMNYnSSVSFEER 2007(48); 2012(33); 2014(unpublished);2007(unpublished);2007;
155 SSAAAMWPGTDVPIHDTISSYFMNYnSSVSFEER 2014(16); 2015(unpublished);2015(unpublished);2015(2);
166 LNnITMWLNNSNPPVTFATLYWEEPDASGHK 2012(52); 2015(unpublished);2015(2);
172 LnNSNPPVTF 2014(33);
172 LNNITMWLnNSNPPVTFATLYWEEPDASGHK 2012(52); 2015(unpublished);2015(2);
202 PEDKEnMSR 2012(48);
202 GPEDKEnMSR 2012(48);
202 YGPEDKEnMSR 2012(48); 2014(13); 2014(16); 2014(33); 2015(unpublished);2015(2); 2015(unpublished);2015(unpublished);
276 InRTEVYNK 2012(48); 2013(34); 2014(13); 2014(14); 2014(16); 2015(unpublished);2015(unpublished);2015(2); 2015(unpublished);
286 IKnCSPHMNVYIK 2014(16);
327 GWTIVLnE 2014(33);
327 TIVLnESSQKL 2014(33);
327 IQPIIIVADEGWTIVInESSQK 2014(16);
327 IQPIILVADEGWTIVLnESSQK 2012(52); 2014(33); 2015(1); 2015(unpublished);2015(2);
386 nGTFGHTK 2015(1);
386 GLKPHPNnGTF 2014(33);
386 ILGLKPHPNnGTFGHTK 2012(48); 2015(unpublished);

Sequence

1112131415161718191
MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKK
101111121131141151161171181191
HFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDK
201211221231241251261271281291
ENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIP
301311321331341351361371381391
NRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW
401411421431441451
CINLPEAIAIVIGSLLVLTMLTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG

Reference

ID Publication
1Sun S, Shah P, Eshghi ST, Yang W, Trikannad N, Yang S, Chen L, Aiyetan P, Hoti N, Zhang Z, et al: Comprehensive analysis of protein glycosylation by solid-phase extraction of N-linked glycans and glycosite-containing peptides. Nat Biotech 2015, advance online publication.
2Shah P, Wang X, Yang W, Eshghi ST, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A: Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation. Molecular & Cellular Proteomics 2015, 14:2753-2763.
13Yang W, Laeyendecker O, Wendel SK, Zhang B, Sun S, Zhou J-Y, Ao M, Moore RD, Jackson JB, Zhang H: Glycoproteomic Study Reveals Altered Plasma Proteins Associated with HIV Elite Suppressors. Theranostics 2014, 4:1153.
14Liu Y, Chen J, Sethi A, Li QK, Chen L, Collins B, Gillet LC, Wollscheid B, Zhang H, Aebersold R: Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness. Molecular & Cellular Proteomics 2014, 13:1753-1768.
16Deeb SJ, Cox J, Schmidt-Supprian M, Mann M: N-linked Glycosylation Enrichment for In-depth Cell Surface Proteomics of Diffuse Large B-cell Lymphoma Subtypes. Molecular & Cellular Proteomics 2014, 13:240-251.
33Zhu J, Sun Z, Cheng K, Chen R, Ye M, Xu B, Sun D, Wang L, Liu J, Wang F, Zou H: Comprehensive Mapping of Protein N-Glycosylation in Human Liver by Combining Hydrophilic Interaction Chromatography and Hydrazide Chemistry. Journal of Proteome Research 2014, 13:1713-1721.
34Sun S, Zhang B, Aiyetan P, Zhou J-Y, Shah P, Yang W, Levine DA, Zhang Z, Chan DW, Zhang H: Analysis of N-glycoproteins using Genomic N-glycosite Prediction. Journal of Proteome Research 2013, 12:5609-5615.
48Danzer C, Eckhardt K, Schmidt A, Fankhauser N, Ribrioux S, Wollscheid B, Mueller L, Schiess R, Zuellig R, Lehmann R, et al: Comprehensive Description of the N-Glycoproteome of Mouse Pancreatic beta-Cells and Human Islets. Journal of Proteome Research 2012, 11:1598-1608.
52Yen T-Y, Macher BA, McDonald CA, Alleyne-Chin C, Timpe LC: Glycoprotein Profiles of Human Breast Cells Demonstrate a Clear Clustering of Normal/Benign versus Malignant Cell Lines and Basal versus Luminal Cell Lines. Journal of Proteome Research 2012, 11:656-667.